DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11695 and znf367

DIOPT Version :9

Sequence 1:	NP_572732.1	Gene:	CG11695 / 32106	FlyBaseID:	FBgn0030316	Length:	544	Species:	Drosophila melanogaster
Sequence 2:	NP_001017726.2	Gene:	znf367 / 550421	ZFINID:	ZDB-GENE-050417-231	Length:	316	Species:	Danio rerio

Alignment Length:	56	Identity:	19/56 - (33%)
Similarity:	30/56 - (53%)	Gaps:	3/56 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   447 KCTHCAKEFKSSRSLEEHTATHTGQDLYECAF--CERTFKNSGNMHKHRRQMHAAQ 500
            :|..|.:.|...:||:.|..||||:..|.|.:  |.:.|..||.:..|:| :|..:
Zfish   122 RCNICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQR-LHTGE 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11695	NP_572732.1	zf-AD	2..81	CDD:285071
		C2H2 Zn finger	268..289	CDD:275368
		C2H2 Zn finger	299..319	CDD:275368
		C2H2 Zn finger	327..348	CDD:275368
		C2H2 Zn finger	357..376	CDD:275368
		C2H2 Zn finger	389..409	CDD:275368
		C2H2 Zn finger	420..440	CDD:275368
		C2H2 Zn finger	448..468	CDD:275368	6/19 (32%)
		C2H2 Zn finger	476..494	CDD:275368	6/19 (32%)
znf367	NP_001017726.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	61..97
		COG5048	115..>182	CDD:227381	19/56 (34%)
		C2H2 Zn finger	123..143	CDD:275368	6/19 (32%)
		C2H2 Zn finger	151..173	CDD:275368	7/22 (32%)
		C2H2 Zn finger	181..200	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	234..294
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.100