powered by:
Protein Alignment CG11695 and znf367
DIOPT Version :9
Sequence 1: | NP_572732.1 |
Gene: | CG11695 / 32106 |
FlyBaseID: | FBgn0030316 |
Length: | 544 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017726.2 |
Gene: | znf367 / 550421 |
ZFINID: | ZDB-GENE-050417-231 |
Length: | 316 |
Species: | Danio rerio |
Alignment Length: | 56 |
Identity: | 19/56 - (33%) |
Similarity: | 30/56 - (53%) |
Gaps: | 3/56 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 447 KCTHCAKEFKSSRSLEEHTATHTGQDLYECAF--CERTFKNSGNMHKHRRQMHAAQ 500
:|..|.:.|...:||:.|..||||:..|.|.: |.:.|..||.:..|:| :|..:
Zfish 122 RCNICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQR-LHTGE 176
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24390 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.