DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and grau

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster


Alignment Length:614 Identity:181/614 - (29%)
Similarity:269/614 - (43%) Gaps:128/614 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ICRLCL---DDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLAD 63
            ||||||   ..|:..:.|||. |||:    |.:||::.:|....:||||.:||.:|..||.|:::
  Fly     3 ICRLCLRGVSGAQMCLQIFDV-DSGE----SKVAEVLRQHFWFEVLPNDEISKVICNVCWTQVSE 62

  Fly    64 FEQFCAMVMKKQL---GLQQLKMEPFSEDEDADTKAQILCEPEIDVSPAAADNEECNEIDGDASS 125
            |.||...:.:.|:   ...:.|.:|    |..:|.     .||..:.||          |..|..
  Fly    63 FHQFYVSIQEAQVIYATTSKFKQDP----EMVNTS-----WPEEVLMPA----------DVLAVD 108

  Fly   126 NSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKT-------HKAEADEDEDA 183
            |...:.|....|.|:.|..|:           :|:...|..|...::       ..|..::|||.
  Fly   109 NDVGAQINVNPLDELDLSQPM-----------SPEDSKVGIKTERQSPDMELLFEDANNEQDEDY 162

  Fly   184 EGEGDPE------SRSSNSREMD-----------SYIALHGRLECCI-----------------C 214
            |.:.|.:      :||...|:.|           ..:...|:.:..:                 |
  Fly   163 EDDEDDDTDDLIVTRSGRKRKRDVAKPAKTKRGTVSVGRKGKEKMVVKRGPPKRIFKMERLPPFC 227

  Fly   215 GGDEQF----------------PNFAEMKRHFRNHH-QSLGYVVCCQRRYKKRALYVDHLHMHND 262
            ..||:.                .:|..::.||::.| ....|:.||.|:..||.|..:|...|.:
  Fly   228 KEDEELIKRYIVMGCELCIFLAEDFDGIREHFKDKHPDERPYIKCCGRKLNKRCLIQEHARRHEN 292

  Fly   263 PNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIH--SRVHQQERNE 325
            |.|.:||.|.|...:......|.|..|...::..|.|:.|.||||::.||.:|  |.|...||..
  Fly   293 PEYIKCKDCGKVFANSSVLRAHWLVHHVPDEECDFQCEDCGKRFSRRNLLELHKGSHVPVNERKF 357

  Fly   326 QCKHCDR--SFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQ 388
            .|..|.:  :|.|...:::|:...|..|  ..||..||.|.|.|.....|.| :|.|.|. |.::
  Fly   358 ICPQCPKHNAFATEYHMQVHISMQHRKA--ANICHVCGKKIKDKAVFEKHVR-LHFEESG-PRIK 418

  Fly   389 C--QECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLE-KGSRAKLAAHIRYHHPKEYHKCTH 450
            |  .:|:.||.||::|::|:..|.|...|  :.|.:||.. |.||| |..|.||.|....:.|..
  Fly   419 CPRPDCESWLKDEDNLKQHLRRHNDEGKL--FICSECGKSCKNSRA-LIGHKRYSHSNVIYTCEQ 480

  Fly   451 CAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMHAAQVAALQQQK-----KV 510
            |.|.||...||:||.|.|||:.||:|.||.|||.::.|||.|:::||..:....::.|     ||
  Fly   481 CGKTFKKDISLKEHMAQHTGEPLYKCPFCPRTFNSNANMHSHKKKMHPVEWDIWRKTKTGSSQKV 545

  Fly   511 PPSKR-----KDKGDLLLDVLAAGGKDMS 534
            .||.:     :|..|     :||...|.|
  Fly   546 LPSAQVAQMFRDDAD-----VAAIANDYS 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 31/84 (37%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 299..319 CDD:275368 10/21 (48%)
C2H2 Zn finger 327..348 CDD:275368 5/22 (23%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 8/21 (38%)
C2H2 Zn finger 420..440 CDD:275368 10/20 (50%)
C2H2 Zn finger 448..468 CDD:275368 10/19 (53%)
C2H2 Zn finger 476..494 CDD:275368 10/17 (59%)
grauNP_788422.1 zf-AD 3..77 CDD:285071 31/78 (40%)
C2H2 Zn finger 272..290 CDD:275368 7/17 (41%)
COG5048 <296..453 CDD:227381 53/162 (33%)
C2H2 Zn finger 298..318 CDD:275368 6/19 (32%)
SIR2 <316..>415 CDD:294129 35/102 (34%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
C2H2 Zn finger 359..409 CDD:275368 16/52 (31%)
C2H2 Zn finger 360..378 CDD:275370 3/17 (18%)
zf-C2H2_8 419..495 CDD:292531 31/78 (40%)
C2H2 Zn finger 450..471 CDD:275368 11/21 (52%)
C2H2 Zn finger 478..498 CDD:275368 10/19 (53%)
C2H2 Zn finger 506..524 CDD:275368 10/17 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25790
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.