DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG6791

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:629 Identity:127/629 - (20%)
Similarity:191/629 - (30%) Gaps:271/629 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CTQCWQQLADFEQFCAMVMKKQLGLQQLKMEPF----SEDEDADTKAQILCEPEIDVSPAAADNE 114
            |..|::...|.::....:      |||..|:..    :|:||.|             :|:|.: :
  Fly   425 CKLCYKGYTDHQEIIRHL------LQQHHMDTLMSEDAEEEDGD-------------APSAIE-D 469

  Fly   115 ECNEIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADE 179
            ||:..:|:...|.                                               |..||
  Fly   470 ECDGDNGNGEGNG-----------------------------------------------APLDE 487

  Fly   180 D----EDAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNH----H-- 234
            |    |||...|   .|.|:    |.....|....|..||.:     |.| |:|:|.|    |  
  Fly   488 DSPYFEDAPRRG---GRISS----DDIFEPHIDYLCPQCGKE-----FIE-KKHWRTHVVMAHSM 539

  Fly   235 ---QSLGYVVCCQRRYK--------KRALYVDHLHMHNDPN-----YFRCKICSKQLVSRISYDV 283
               ..|.:.:..:|:.|        ..|..:.:...|...:     |.||:.|.|....|.....
  Fly   540 NDLSKLNFEMINERQLKCTECDKIITNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVK 604

  Fly   284 HMLRFH----PNKDDLSFACD----QCSKRFSKQFLLTIHSRVH--------------------- 319
            |:...|    |.|  ||..|.    ..:|:..|| ::|:.:..:                     
  Fly   605 HLATHHRVGWPRK--LSGGCPAPILTPAKQPRKQ-IVTVANETYEIIYLDDVDQGGMEEDNDFGE 666

  Fly   320 --QQERNE-------------------------QCKHCDRSFRTAVDLRLH----------MRRT 347
              |.|.:|                         :|.||...|.|...:|:|          :||.
  Fly   667 QMQAEEDEYPIAPPPPSPPPPPQPTTQGNHQRYKCVHCGTLFATQAAVRVHISEKRCRKTVVRRR 731

  Fly   348 HDPAF------VP-------FICDSCGAKFKTKQNLLVHKRTVH----REGSQLPEV-----QCQ 390
            ..|..      ||       |:|.|||.::||:.....|...||    |:...:.::     ||.
  Fly   732 RQPVMSSADPSVPTVEQNYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYRYQCT 796

  Fly   391 ECQ--VWLSDENSLRKHMYMHLDAASLRQW-KCEQCGLEKGSRAKLAAHIRYHH----------- 441
            :|:  |..|....|:.|.:.||   ..|.: ||..||.....:..:|||:|..|           
  Fly   797 QCKDIVCNSKLKGLQDHHFRHL---PYRLYLKCLICGTCYNHKPNIAAHLRARHSIFDRETPTMI 858

  Fly   442 --PKEY---HK---------------------------CTHCAKEFKSSRS-------------- 460
              ||:.   :|                           |:..|....||||              
  Fly   859 TKPKQVLGRYKDNSRENPKLPSPPPAPALAPAPPSPPACSSSAAASASSRSLKPQPGGLPARPAG 923

  Fly   461 ---LEEHTATHTGQDL----YECAFCERTFKNSGNMHKHRRQMH 497
               ||:..:.|...||    |.|..|.:.|.:.....||..:.|
  Fly   924 LNTLEDSISYHNAVDLDFITYFCPKCNQNFDSHAFWRKHIVEQH 967

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 5/26 (19%)
C2H2 Zn finger 268..289 CDD:275368 5/20 (25%)
C2H2 Zn finger 299..319 CDD:275368 5/23 (22%)
C2H2 Zn finger 327..348 CDD:275368 9/30 (30%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 6/21 (29%)
C2H2 Zn finger 420..440 CDD:275368 7/19 (37%)
C2H2 Zn finger 448..468 CDD:275368 8/36 (22%)
C2H2 Zn finger 476..494 CDD:275368 5/17 (29%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368 8/21 (38%)
C2H2 Zn finger 557..580 CDD:275368 2/22 (9%)
C2H2 Zn finger 589..609 CDD:275368 5/19 (26%)
COG5236 <939..>1096 CDD:227561 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.