DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG6254

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:532 Identity:121/532 - (22%)
Similarity:198/532 - (37%) Gaps:119/532 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CRLCLDDAEH--------SVPIFDQDD----SGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCT 55
            |.:..|..:|        |:|   |:|    |.:||:........:...:::::||..|.|    
  Fly   117 CGVATDGWKHIMLGAVDESLP---QNDEVFISEEQPIVCQTETSSKMKSEILMIPNFLVEK---- 174

  Fly    56 QCWQQLADFEQFCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEPEIDVSPAAAD--NEECNE 118
            ||.|:..||.:. ..|:::::.:..::.|...||.:.|     |.|.|::......|  .||...
  Fly   175 QCLQEKQDFPKE-EDVIEEEMQISGVEEEILEEDVEED-----LAEEEVETVEEEIDTVGEEVEA 233

  Fly   119 IDGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTA-------------PKTQAVKAKART 170
            ::.:..:...:..: ...:..|.....|.....:..:..:             |:.:.|:.|...
  Fly   234 VEEELETQDATDCL-VEEVEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPVETKDTV 297

  Fly   171 KTHKAEADEDEDAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQ 235
            ::.::..|..||.            |||                              |..:...
  Fly   298 ESIESNEDTQEDI------------SRE------------------------------HVTDEED 320

  Fly   236 SLGYVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPN-KDDL-SFA 298
            .:..|                      |..::|.||.|......:|..||...|.. .||| ...
  Fly   321 EISEV----------------------PAMYKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLE 363

  Fly   299 CDQCSKRFSKQFLLTIHSRVH---QQERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSC 360
            |:||...|.....|..|.|.|   :.:.:..|.||::.|.|:..|:.|:...|: ...|::||.|
  Fly   364 CNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEKRFTTSGTLKRHIEGIHN-QIKPYVCDLC 427

  Fly   361 GAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGL 425
            |..|.....|..|| .||.:  :.| .:|..|:....:...|:    :|||..|...::|..|||
  Fly   428 GKSFNYITGLKDHK-LVHTD--ECP-FECPVCKRGFKNNARLK----IHLDTHSAEIYECTVCGL 484

  Fly   426 EKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMH 490
            :..:|.....|...|......||..|...||.|::|:.|...|||...|:|.||.|.|.|..|..
  Fly   485 KLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFANGSNCR 549

  Fly   491 KHRRQMHAAQVA 502
            .|:||.|..::|
  Fly   550 SHKRQAHPKELA 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 20/89 (22%)
C2H2 Zn finger 268..289 CDD:275368 7/20 (35%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 7/20 (35%)
C2H2 Zn finger 357..376 CDD:275368 8/18 (44%)
C2H2 Zn finger 389..409 CDD:275368 3/19 (16%)
C2H2 Zn finger 420..440 CDD:275368 6/19 (32%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 8/17 (47%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 65/209 (31%)
C2H2 Zn finger 364..384 CDD:275368 7/19 (37%)
C2H2 Zn finger 395..416 CDD:275368 7/20 (35%)
C2H2 Zn finger 424..444 CDD:275368 8/20 (40%)
C2H2 Zn finger 452..472 CDD:275368 6/23 (26%)
C2H2 Zn finger 479..499 CDD:275368 6/19 (32%)
C2H2 Zn finger 507..527 CDD:275368 7/19 (37%)
zf-H2C2_2 520..544 CDD:290200 11/23 (48%)
C2H2 Zn finger 535..553 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.