DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG8319

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster


Alignment Length:504 Identity:102/504 - (20%)
Similarity:186/504 - (36%) Gaps:152/504 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ICRLCLDDAEHSVPIFDQDDSGDQPVP-SNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLA--- 62
            :||:|...:|:.:.||  ||..::.|. :.|||:::....:.|.|:|.:.:.:|..|.....   
  Fly     4 LCRICGGASENMLGIF--DDQVEEYVDGAKLAEMVKTCADVQLDPDDAMPQKMCISCVHDARTAY 66

  Fly    63 DFEQFCAMVMKK----QLGLQQLKMEPFSED----EDADTKAQILCEPEIDVSPAAADNEECNEI 119
            .|::.|....||    .|..|.:|.||..||    |:.| |..:..:.::        |:|..:.
  Fly    67 GFKRRCEENYKKFYLAILNGQVIKDEPNEEDFLFIENPD-KGNLEAKKKL--------NKEIKKT 122

  Fly   120 DGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAE 184
            ...||..::||...:.:.|::|                         ..:.:|.|.|        
  Fly   123 HQTASRTTKSSITTSRAGRQLR-------------------------SIKNQTFKCE-------- 154

  Fly   185 GEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKK 249
                                                                     .|.:::|:
  Fly   155 ---------------------------------------------------------LCIKQFKR 162

  Fly   250 RALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTI 314
            :...:||:.:|:  |...|:.|.::.:.:...|.|....:.|.   :..|.:|.|.||....|..
  Fly   163 QINLLDHMKVHS--NSHVCQNCEERFLFKADLDNHQCYRNSNS---TVECPECLKVFSSTQSLDS 222

  Fly   315 HSRVHQQERNE-QCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVH 378
            |.....|||:. ||.||.::|....:|:.|                          ||:|..:..
  Fly   223 HKCKDMQERSPFQCPHCQQAFTREQNLKAH--------------------------LLIHAESKQ 261

  Fly   379 REGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPK 443
            ..|..    :|..||....::::|:.|::.|:..   |...|..|.....|:..|..|||.|..:
  Fly   262 GNGPH----KCSYCQTGFFNKSALKVHIHAHMGE---RPHACPFCVSNFRSKQALKVHIRIHTGE 319

  Fly   444 EYHKCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKH 492
            :.::|.||.|.|..:.:|.:|...|:.:..|:|:.|.:.|:...::.:|
  Fly   320 KPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 23/86 (27%)
C2H2 Zn finger 268..289 CDD:275368 4/20 (20%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 6/20 (30%)
C2H2 Zn finger 357..376 CDD:275368 3/18 (17%)
C2H2 Zn finger 389..409 CDD:275368 5/19 (26%)
C2H2 Zn finger 420..440 CDD:275368 7/19 (37%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 4/17 (24%)
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 20/76 (26%)
COG5048 <153..368 CDD:227381 60/317 (19%)
C2H2 Zn finger 153..173 CDD:275368 5/84 (6%)
C2H2 Zn finger 179..196 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..227 CDD:275370 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 8/45 (18%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 308..332 CDD:290200 9/23 (39%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.