DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG8089

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:380 Identity:81/380 - (21%)
Similarity:127/380 - (33%) Gaps:99/380 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLR-------FHPNK------- 292
            |....:||.....||...|...:.|.|:||.::...:.|...|::|       .|.||       
  Fly   174 CENLPWKKLQDVEDHQKTHRYSDNFHCQICYRRFYLQHSLTSHIIRKSTSSRELHENKRYKRLLE 238

  Fly   293 -------------------------DDLS-------------------FACDQCSKRFSKQFLLT 313
                                     :||.                   ..|..|::.:...|...
  Fly   239 NQKSQEEKELELSLNKVEDILVPVAEDLQSYFKDESKHPIQKRKTSSLSKCPSCAQNYGFSFSHQ 303

  Fly   314 IHSRVHQQER-----NEQCKHCDRSFRTAVDLRLHMRRTHDPA---FVPFICDSCGAKFKTKQNL 370
            :|...|::||     ...|..|:|||.|...||.|.:|....:   :.||.|..|..:|:.|..|
  Fly   304 LHMVKHRRERLYTNFPFHCSFCNRSFLTRKFLRKHQQRVRTFSTLLYRPFKCPHCTWRFQLKSAL 368

  Fly   371 LVHKRTVHREGS-----QLPEVQ-CQECQVWLSDENSLRKHMYMHLDAASLRQWK---------- 419
            ..|...:|....     :||..: |  |....|.|  ..:.|..:.|  .:|..:          
  Fly   369 DSHVLRIHERRKPCLICKLPTSRLC--CSAHTSKE--CNRAMQKYRD--KMRPLREPPKGGCRKQ 427

  Fly   420 ----CEQCGLEKGSRAKLAAHI-RYHHPKEYHKCTHCAKEFKSSRSLEEH-TATHTGQDLYECAF 478
                |:.|..:...:..|..|: :.|..|....|..|...|.|..:::.| .|.|......:|..
  Fly   428 PTPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGTMQTHRKAVHLLVHTVQCEV 492

  Fly   479 CERTFKNSGNMHKH-RRQMHAAQVAALQQQKKVPPSKRKDKG----DLLLDVLAA 528
            |:.|.|:.||..:| :.|.|...:....:.........:.||    |..||:.|:
  Fly   493 CDLTIKSKGNYRRHCKSQSHKDNLVKFGKNNDKTKDSNRRKGARTTDEKLDIEAS 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368 6/27 (22%)
C2H2 Zn finger 299..319 CDD:275368 4/19 (21%)
C2H2 Zn finger 327..348 CDD:275368 10/20 (50%)
C2H2 Zn finger 357..376 CDD:275368 6/18 (33%)
C2H2 Zn finger 389..409 CDD:275368 5/19 (26%)
C2H2 Zn finger 420..440 CDD:275368 4/20 (20%)
C2H2 Zn finger 448..468 CDD:275368 6/20 (30%)
C2H2 Zn finger 476..494 CDD:275368 7/18 (39%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
C2H2 Zn finger 322..343 CDD:275368 10/20 (50%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 432..453 CDD:275368 4/20 (20%)
C2H2 Zn finger 461..486 CDD:275368 7/24 (29%)
C2H2 Zn finger 490..506 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.