DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG30020

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:506 Identity:98/506 - (19%)
Similarity:163/506 - (32%) Gaps:158/506 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VMKKQLGLQQLK--------MEPFSEDEDADTKAQILCEPEIDVSPAAADNEECNEIDGDASSNS 127
            :|:..:|.:::.        .|....|:....||: ...||.::.|...|..........|::.|
  Fly   926 MMQTDVGAEKMTEALGNGDGNEEGGTDDGTGVKAE-PAVPEEELDPVTLDAATAVTTTAIAAAIS 989

  Fly   128 RSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAEGEGDPESR 192
            .:::...|||.     ||:                |..|.:.|.........|.|.:...|...:
  Fly   990 AAAAATATSLE-----SPV----------------ATTASSSTTLFPTPTPFDFDYDIMRDEAQQ 1033

  Fly   193 SS-NSREMDSYIALHGRLECCICGGDEQFPNFAE----------MKRHFRNHHQSLGYVVCCQRR 246
            || |..::...::.:....|.|   :|.:...:.          ::.:.|.|..|:         
  Fly  1034 SSPNIHDVSKALSDNASSSCPI---NESYKLLSTTALETSPAKGLRSNSRLHRSSI--------- 1086

  Fly   247 YKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKD----DLSFACDQCSKRFS 307
                     |:          ||:|::..........|.:..|.|.:    .....|..|:..:.
  Fly  1087 ---------HI----------CKLCNQTFDELGKLVKHEMELHSNTERSRWGYQHKCAICNTSYR 1132

  Fly   308 KQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMRRTH--DPAFVPFICDSCGAKFKTKQNL 370
            ...||..|.:.| ..|..|||.|.:||.|..:|..|.:..|  |.....|: |.|...|..|.:|
  Fly  1133 TLTLLKFHMKRH-SNRKSQCKLCPKSFVTIAELERHTKAKHSKDKTLRCFM-DGCRKTFAFKHHL 1195

  Fly   371 LVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAA 435
            :.|::..|                 ||                                      
  Fly  1196 IRHQKASH-----------------LS-------------------------------------- 1205

  Fly   436 HIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMH--- 497
             .||       .|..|.||.||:..|:.|.:.|.|:..|:|..|:|::...|.:..|...:|   
  Fly  1206 -TRY-------ICPVCNKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYLRRGRLVTHALIIHDLR 1262

  Fly   498 -----AAQVAALQQQKKVPPSKRKDKGDLLLDVLAAGGKDMSHVMGAGDMN 543
                 ...:::|...:..|...:......|||    |.||:|   ||.:.|
  Fly  1263 FTTEELGNLSSLATNQARPNDLKVATPVGLLD----GRKDVS---GASEEN 1306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 2/9 (22%)
C2H2 Zn finger 268..289 CDD:275368 4/20 (20%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..348 CDD:275368 8/20 (40%)
C2H2 Zn finger 357..376 CDD:275368 6/18 (33%)
C2H2 Zn finger 389..409 CDD:275368 2/19 (11%)
C2H2 Zn finger 420..440 CDD:275368 1/19 (5%)
C2H2 Zn finger 448..468 CDD:275368 8/19 (42%)
C2H2 Zn finger 476..494 CDD:275368 5/17 (29%)
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 4/20 (20%)
C2H2 Zn finger 1124..1144 CDD:275368 5/19 (26%)
C2H2 Zn finger 1151..1172 CDD:275368 8/20 (40%)
C2H2 Zn finger 1180..1203 CDD:275368 7/23 (30%)
C2H2 Zn finger 1210..1230 CDD:275368 8/19 (42%)
C2H2 Zn finger 1238..1254 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.