DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG18011

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_610559.1 Gene:CG18011 / 36068 FlyBaseID:FBgn0033491 Length:985 Species:Drosophila melanogaster


Alignment Length:479 Identity:88/479 - (18%)
Similarity:144/479 - (30%) Gaps:194/479 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 YIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVC--CQRRYKKRALYVDHLHMHND-- 262
            ::..|....|.:|  |....|..|:.:|....|:.:|.:.|  |.|.::..:::::|...|.:  
  Fly   450 HLEKHRPRACFVC--DYATTNIDELFQHLNYSHEPVGTLFCDLCDRTFRDPSVFMEHNKSHANVS 512

  Fly   263 ----------PNY-----------------FRCKICSKQLVSRISYDVHM--------------- 285
                      .|:                 ..|::||::..:..:|::||               
  Fly   513 STTYSCSECMANFESRGRLNGHMRAMHGSVISCELCSREFATEATYNIHMKKHLIIEKDVHVCST 577

  Fly   286 ----------LRFHPN-------------------------------KDDLS------------F 297
                      |..|.|                               ||.|.            |
  Fly   578 CGLLSDSRETLLAHVNSVKTACFGSKIDVELLRDAYVCEYCSSYFKEKDCLQAHRDSGVHKDGVF 642

  Fly   298 ACDQCSKRFSKQFLLTIHSRVHQQERNEQ------------------------------------ 326
            .|..|.|.|....|...|.|.:||.|::.                                    
  Fly   643 LCQPCGKEFPHMKLYRHHLRNYQQLRSDSTHRRLEICVYYMCDQENCTESYVNWNSLYTHKRRTH 707

  Fly   327 ------------------CKHCDRSFRTAVDLRLHMRRTHDPAFV-------------------- 353
                              |:.|.:..|:.:.|.:|:.|:|:...|                    
  Fly   708 ESASKQAEKSSKSAQEWVCQFCLKECRSKMSLSVHVARSHNNDNVTCPLCNSSYKSHDALAKHHA 772

  Fly   354 ----PFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAAS 414
                |..|..|....|.::|...|...||   |......|..||.....::.:..|..:|     
  Fly   773 YWHEPIECPECFKIVKNRRNYDTHVNVVH---SNKKRYSCSVCQKGFYHKSEMEAHQKLH----- 829

  Fly   415 LRQWKCEQCGLEKGSRAKLAAHIRYHHPKEY-HKCTHCAKEFKSSRSLEEHTATHTGQDLYEC-- 476
            .:.:.||||.....::..|:.|:...|.|.: .:|..|.|.|..|:.|:.|.....| |.|.|  
  Fly   830 GQSYSCEQCSFTTRNKKSLSVHVLGQHYKRFAFECNVCKKRFGRSQGLKTHMQRAHG-DKYTCRD 893

  Fly   477 ---AFCERTFKNSGNMHKHRRQMH 497
               ..|.|||.||..::.|.|::|
  Fly   894 YFDGGCGRTFVNSSQLNVHVRKIH 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368 7/45 (16%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 6/20 (30%)
C2H2 Zn finger 357..376 CDD:275368 5/18 (28%)
C2H2 Zn finger 389..409 CDD:275368 4/19 (21%)
C2H2 Zn finger 420..440 CDD:275368 6/19 (32%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 8/22 (36%)
CG18011NP_610559.1 PRK14950 <98..>184 CDD:237864
C2H2 Zn finger 488..508 CDD:275368 4/19 (21%)
C2H2 Zn finger 518..538 CDD:275368 1/19 (5%)
C2H2 Zn finger 545..565 CDD:275368 6/19 (32%)
C2H2 Zn finger 575..596 CDD:275371 3/20 (15%)
SFP1 <682..747 CDD:227516 6/64 (9%)
C2H2 Zn finger 754..775 CDD:275368 0/20 (0%)
C2H2 Zn finger 780..801 CDD:275368 5/20 (25%)
C2H2 Zn finger 809..829 CDD:275368 4/19 (21%)
C2H2 Zn finger 864..885 CDD:275368 7/20 (35%)
C2H2 Zn finger 891..917 CDD:275368 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.