DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG17612

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:517 Identity:105/517 - (20%)
Similarity:181/517 - (35%) Gaps:146/517 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CRLCLDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFEQF 67
            ||:||:.:::...||  ||:....:|  :|.::.::..:.:...|..|:.:|..|          
  Fly   187 CRVCLEQSDNLTNIF--DDAHQYGIP--IATILSQYTGMPVEKGDSFSEYICVTC---------- 237

  Fly    68 CAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEPE---IDVSPAAADNEECN-EIDGDASSNSR 128
                      |..:| ..|.:.|..:...|:..:|:   ||:......|:..: |:.|       
  Fly   238 ----------LDVVK-NAFDDLESKENTIQMYRQPKEEIIDIDSIPVKNKPVDYEVTG------- 284

  Fly   129 SSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAEGEGDPESRS 193
                           .|..|..:.|:....    |.|.:|..:||.               |:|:
  Fly   285 ---------------KPPHRCPQCPKIFLL----AAKLQAHIRTHN---------------ETRT 315

  Fly   194 SNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHLH 258
            :..          .||:|.:|      |:.                       |.||.....|:.
  Fly   316 TEP----------PRLKCPMC------PSI-----------------------YMKRGCLEAHMW 341

  Fly   259 MHN---------DPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDL----SFACDQCSKRFSKQF 310
            :|.         :|.| ||..|.|..:.....::|:.........|    |..|.||:..||...
  Fly   342 IHRASDERESELEPPY-RCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVS 405

  Fly   311 LLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKR 375
            .|..|.::|..||..:|..|..||:...:|     ::||.|...|.|..|...|:::..|..|.:
  Fly   406 SLKDHVKIHAGERTFKCPLCLMSFQEESNL-----KSHDCAHTRFKCHKCSKFFESQNYLDFHFK 465

  Fly   376 TVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQ------WKCEQC----GLEKGSR 430
            ..|......   :|.:||......|.|::|:...:....||.      :.|.:|    .:|...:
  Fly   466 KSHTTKGPF---KCIKCQQTFQKRNGLKEHISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDNYQ 527

  Fly   431 AKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKH 492
            ...|.|.:.....|.|.||.|.|.:::.:.|.:|..:|.     .|..|..:|.:...:.:|
  Fly   528 MHHATHKKVKTVIERHNCTQCKKSYQNKKLLTKHILSHN-----RCVHCSMSFTSKYLLEQH 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 15/77 (19%)
C2H2 Zn finger 268..289 CDD:275368 4/20 (20%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 5/20 (25%)
C2H2 Zn finger 357..376 CDD:275368 5/18 (28%)
C2H2 Zn finger 389..409 CDD:275368 6/19 (32%)
C2H2 Zn finger 420..440 CDD:275368 5/23 (22%)
C2H2 Zn finger 448..468 CDD:275368 6/19 (32%)
C2H2 Zn finger 476..494 CDD:275368 4/17 (24%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 16/83 (19%)
C2H2 Zn finger 290..310 CDD:275368 4/23 (17%)
C2H2 Zn finger 323..343 CDD:275370 7/48 (15%)
zf-C2H2_8 356..438 CDD:292531 23/87 (26%)
C2H2 Zn finger 359..379 CDD:275368 4/19 (21%)
C2H2 Zn finger 394..414 CDD:275368 7/19 (37%)
C2H2 Zn finger 422..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 447..463 CDD:275368 4/15 (27%)
C2H2 Zn finger 476..505 CDD:275368 8/28 (29%)
C2H2 Zn finger 513..533 CDD:275368 4/19 (21%)
C2H2 Zn finger 545..565 CDD:275368 6/19 (32%)
C2H2 Zn finger 568..584 CDD:275368 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.