DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG3407

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_608809.1 Gene:CG3407 / 33606 FlyBaseID:FBgn0031573 Length:714 Species:Drosophila melanogaster


Alignment Length:453 Identity:108/453 - (23%)
Similarity:171/453 - (37%) Gaps:87/453 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 FSEDEDADTKAQILCEPEIDVSPAAADNEECNE-IDGDASSNSRSSSIRTTSLREMRLPS----- 144
            ||:.||       :.|...:|....:..:.|:| :|.:.:|:..::.....:.|::..|:     
  Fly   294 FSDTED-------MLEGIRNVVDKVSIEDTCDELVDLELTSSGMTAPWFNNNFRDITFPALLLPG 351

  Fly   145 -PIRRRMRLPRAVTAPKTQAVKAKARTKTHKA---EADEDEDAEGEGDPESRSSNSREMDSYIAL 205
             |       |.|.:.|.|..:|.......|.|   .:.|..|.:.|...|...|.:.|.:....|
  Fly   352 EP-------PPASSEPATPLLKENPHVGDHMALDFLSPEKADPQEEAKLEKTLSKACEPNEQTLL 409

  Fly   206 HGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHL--------HMHND 262
            .....|       |.|....:.....:..|.....:.....:|   |..|.:        ....|
  Fly   410 VAPPAC-------QTPPIPTVPPANSSIEQLRRSPLELSEAFK---LEEDDMTDSRPASSFEEGD 464

  Fly   263 PNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQC 327
            |:......|.:..|    .|..:.....||......||:|::.|:....|..|...|.|||:.:|
  Fly   465 PDAEEPNECFQMEV----LDTSLTEEAENKTRRKHFCDKCNRDFNSYNALKYHQYTHNQERSHKC 525

  Fly   328 KHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQEC 392
            ..|:|||.|...|:.| .|||. ...||.||.|..:|:...:|..|                   
  Fly   526 DSCERSFYTQSALKAH-ERTHS-GVKPFKCDKCEFQFRQWGDLKYH------------------- 569

  Fly   393 QVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKS 457
              .:|..:.::.||             ||.||.....|..|..|.|.|..::.:.|.:|.|.|::
  Fly   570 --IISRHSDVKAHM-------------CEFCGKSFSRRYSLVVHRRIHTREKNYACQYCDKTFRA 619

  Fly   458 SRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMH----AAQVAALQQQKKVPPSKRK 516
            |..|..|...|||:..|||:.||:.|:.||::.:|.| :|    .:|..|.:.:||...:..|
  Fly   620 SSYLLSHIKVHTGERPYECSICEKKFRVSGDLKRHSR-IHDPSRTSQPPAEKAKKKRAAASNK 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368 3/20 (15%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..348 CDD:275368 9/20 (45%)
C2H2 Zn finger 357..376 CDD:275368 6/18 (33%)
C2H2 Zn finger 389..409 CDD:275368 3/19 (16%)
C2H2 Zn finger 420..440 CDD:275368 8/19 (42%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 7/17 (41%)
CG3407NP_608809.1 COG5048 <494..656 CDD:227381 60/197 (30%)
C2H2 Zn finger 497..517 CDD:275368 6/19 (32%)
zf-H2C2_2 509..534 CDD:290200 11/24 (46%)
C2H2 Zn finger 525..545 CDD:275368 9/20 (45%)
zf-H2C2_2 537..562 CDD:290200 11/26 (42%)
C2H2 Zn finger 555..574 CDD:275371 5/39 (13%)
zf-C2H2 580..602 CDD:278523 10/34 (29%)
C2H2 Zn finger 582..602 CDD:275368 8/19 (42%)
zf-H2C2_2 594..617 CDD:290200 7/22 (32%)
C2H2 Zn finger 610..630 CDD:275368 7/19 (37%)
zf-H2C2_2 622..645 CDD:290200 10/22 (45%)
zf-C2H2 636..658 CDD:278523 10/22 (45%)
C2H2 Zn finger 638..658 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.