DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG8944

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster


Alignment Length:308 Identity:70/308 - (22%)
Similarity:121/308 - (39%) Gaps:51/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 RNHHQSLGYVVCCQRRYKKRALYVDHLH-MHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDD 294
            |.:.:.||      :::....||.|.:| |.:|...|:|..|.:.:.:....|:|||...|:...
  Fly   444 RLNSERLG------KKFIANYLYYDQMHFMDDDIPPFKCAHCPEIVQTLRELDLHMLTHQPSLGG 502

  Fly   295 LSFACDQCSKRFSKQFLLTIHSRVH---QQERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFI 356
             .:.|:.||.:|........|.::|   ..|....|:.|..|||...:...|:||.::..|:|.:
  Fly   503 -GYYCNICSIQFHNAQEFDNHKQLHLGGVTEIKFNCELCTASFREKANYDEHLRRHNEELFLPSL 566

  Fly   357 C------------DSCGAKFKTKQNLLVHKRTVHRE------------------------GSQLP 385
            .            |..|.:.:..:.....::..|..                        |:.:.
  Fly   567 ALNHSIMEGGLGDDEIGVEGEESRGSGSRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIA 631

  Fly   386 E-VQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCE--QCGLEKGSRAKLAAHIRYHHPKEYHK 447
            : ..|..|:...:....|..|..:|.|... |.:||:  ||.....:|..|..|::.|:..|..|
  Fly   632 KPYGCDVCRRSFATPGHLNAHRIVHQDERE-RCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFK 695

  Fly   448 CTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQ 495
            |..|.|.|||:::|:.|...|.....|.|..|...|..:..::.|:|:
  Fly   696 CDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYLHKRR 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..348 CDD:275368 8/20 (40%)
C2H2 Zn finger 357..376 CDD:275368 2/30 (7%)
C2H2 Zn finger 389..409 CDD:275368 4/19 (21%)
C2H2 Zn finger 420..440 CDD:275368 6/21 (29%)
C2H2 Zn finger 448..468 CDD:275368 8/19 (42%)
C2H2 Zn finger 476..494 CDD:275368 4/17 (24%)
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738 9/33 (27%)
C2H2 Zn finger 476..496 CDD:275368 6/19 (32%)
C2H2 Zn finger 506..526 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 636..656 CDD:275368 4/19 (21%)
zf-C2H2_8 639..712 CDD:292531 23/73 (32%)
C2H2 Zn finger 666..688 CDD:275368 6/21 (29%)
zf-C2H2 694..716 CDD:278523 9/21 (43%)
C2H2 Zn finger 696..716 CDD:275368 8/19 (42%)
zf-H2C2_2 708..733 CDD:290200 7/24 (29%)
C2H2 Zn finger 724..744 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.