DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG11696

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:595 Identity:242/595 - (40%)
Similarity:313/595 - (52%) Gaps:107/595 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFE 65
            |||||||:||||.||||.|:....||....||||||:||.|||..||.||..||.:||:|||:.|
  Fly     1 MICRLCLEDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIE 65

  Fly    66 QFCAMVMKKQLGLQ---QLK------------------------MEPFSEDEDADTKAQILCEPE 103
            |||:||.:||..|.   |||                        :||....|..|.|..|||||.
  Fly    66 QFCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILCEPV 130

  Fly   104 IDVSPAA--ADNEECNEIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMR-LPRAVTAPKT-QAV 164
            ||...|.  .|::..:..:.|....|:...      .|...|.|::.|.| .||.....:| |.:
  Fly   131 IDALSAGDEKDSDYGDTFEPDFEPESQPDE------EEEPEPDPVKPRPRGRPRKTALQQTHQII 189

  Fly   165 KAK--ARTKTHKA----------------------------EADEDEDAE----GEGDPES---- 191
            |.|  .|.:.:||                            :.||||:.|    ||..|::    
  Fly   190 KRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQP 254

  Fly   192 ----------------------------RSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKR 228
                                        :.|:.:|||.|||.:.:|:|.||..  ...:|.::||
  Fly   255 KPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAA--PLEDFNDLKR 317

  Fly   229 HFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKD 293
            |||..|...|||.||..|||||.|||||||.|.||.||.|:.|.|..::|.|..:||||||..:.
  Fly   318 HFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQ 382

  Fly   294 DLSFACDQCSKRFSKQFLLTIHSRVHQ-QERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFIC 357
            :|...|..|..||:|:||||:|.:.|: .||.|.|..|.::|||..:|..|::|.|...|.|.||
  Fly   383 ELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIIC 447

  Fly   358 DSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQ 422
            |.||..|::|.|.|:||:.:|.:| .:.||||..|..||.||.|||||:..|.|.....:::|..
  Fly   448 DICGTHFRSKANFLIHKKALHPDG-PVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLL 511

  Fly   423 CGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSG 487
            |..||.|||.|::|:||||..:.|||:.|.||||..|:|.||.|||||.|||:|.||.||||:..
  Fly   512 CNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHA 576

  Fly   488 NMHKHRRQMH 497
            |||.|:::||
  Fly   577 NMHNHKKKMH 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 48/81 (59%)
C2H2 Zn finger 268..289 CDD:275368 9/20 (45%)
C2H2 Zn finger 299..319 CDD:275368 10/19 (53%)
C2H2 Zn finger 327..348 CDD:275368 8/20 (40%)
C2H2 Zn finger 357..376 CDD:275368 10/18 (56%)
C2H2 Zn finger 389..409 CDD:275368 11/19 (58%)
C2H2 Zn finger 420..440 CDD:275368 10/19 (53%)
C2H2 Zn finger 448..468 CDD:275368 11/19 (58%)
C2H2 Zn finger 476..494 CDD:275368 11/17 (65%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 47/75 (63%)
C2H2 Zn finger 332..349 CDD:275368 13/16 (81%)
C2H2 Zn finger 357..378 CDD:275368 9/20 (45%)
C2H2 Zn finger 388..408 CDD:275368 10/19 (53%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 447..465 CDD:275368 9/17 (53%)
C2H2 Zn finger 478..498 CDD:275368 11/19 (58%)
C2H2 Zn finger 509..529 CDD:275368 10/19 (53%)
C2H2 Zn finger 537..557 CDD:275368 11/19 (58%)
C2H2 Zn finger 565..583 CDD:275368 11/17 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C0KF
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.