DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG3032

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:556 Identity:127/556 - (22%)
Similarity:187/556 - (33%) Gaps:204/556 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ICRLCLDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVL---------LPNDGVSKSLCTQC 57
            :|..||...|.. |:..:..|.:.|:...|.:|:..:|...:         |||:     ||.:|
  Fly    13 LCCTCLLQLEKE-PLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWLPNE-----LCLEC 71

  Fly    58 WQQLADFEQF------CAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEPEIDVSPAAADNEEC 116
            ...:.:||:|      |    :||| |:.||.:|              .||..:|   ..|..|.
  Fly    72 RSAVQNFEKFRRKADEC----RKQL-LEMLKKDP--------------REPTFEV---VYDGREE 114

  Fly   117 NEIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDE 181
            ::                .||..:..|.|            ||                      
  Fly   115 DQ----------------ESLHGLEPPEP------------AP---------------------- 129

  Fly   182 DAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRR 246
            |.:...:|..:|..|                             .::.||....:|         
  Fly   130 DPDPIDEPAIKSDKS-----------------------------PRKSFRGSRNTL--------- 156

  Fly   247 YKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFL 311
                                :|.:|.:....:|:...|:.:.|.. ....|.||||.|.:|....
  Fly   157 --------------------KCSVCRRSFAHQITLAAHIRKVHEG-SKRPFQCDQCEKAYSFMGG 200

  Fly   312 LTIHSR-VH-QQERNEQCKH--CDRSFRTAVDLRLHMRRTHDP----AFVPFICDSCGAKFKTKQ 368
            |..|.| || .:||...|..  |:|.:.:.:.::.|.|..|.|    |...|||:.|||.|....
  Fly   201 LYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQSA 265

  Fly   369 NLLVHKRTVH--------REGS-------------------------QLPEVQ------CQECQV 394
            ||..|.:|.|        |||.                         |..|||      ||.|..
  Fly   266 NLKYHLKTKHPTEDEVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHEVQEELPHECQVCGR 330

  Fly   395 WLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPK-EYHKCTHCAKEFKSS 458
            .::.:..|.:||.||    |..:..||.||.....|.:|.||:|..|.| :...|.||.:.|.|.
  Fly   331 RMAKKFMLLQHMLMH----SNDKLPCEHCGRRFARRFELEAHVRAVHLKLKPFPCHHCPESFASR 391

  Fly   459 RSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRR 494
            ::|..|...|||:..|.|..|.:.|:....:..||:
  Fly   392 KTLRHHEYIHTGEKPYICDTCGQAFRQQTCLKNHRK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 24/93 (26%)
C2H2 Zn finger 268..289 CDD:275368 4/20 (20%)
C2H2 Zn finger 299..319 CDD:275368 9/20 (45%)
C2H2 Zn finger 327..348 CDD:275368 5/22 (23%)
C2H2 Zn finger 357..376 CDD:275368 8/18 (44%)
C2H2 Zn finger 389..409 CDD:275368 6/19 (32%)
C2H2 Zn finger 420..440 CDD:275368 9/19 (47%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 4/17 (24%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 24/92 (26%)
C2H2 Zn finger 158..179 CDD:275368 4/20 (20%)
C2H2 Zn finger 188..209 CDD:275368 9/20 (45%)
C2H2 Zn finger 218..239 CDD:275368 4/20 (20%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
C2H2 Zn finger 294..315 CDD:275368 1/20 (5%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 9/20 (45%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
C2H2 Zn finger 409..429 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.