DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and CG12219

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster


Alignment Length:657 Identity:140/657 - (21%)
Similarity:196/657 - (29%) Gaps:249/657 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLD--DAEHSVPIFDQDDSGDQPVP-----------SNLAELIEKHLQLVLLPNDGVSKS 52
            |||||||:  |.:.:|.:||.......|.|           |.|.:||..||.|.|..:|.:|..
  Fly     1 MICRLCLNALDEQSAVLLFDGAGGASAPAPDDEDDGKAMPESYLVQLISIHLYLCLSRDDAISTC 65

  Fly    53 LCTQCWQQLADFEQFCAMVMKKQLGL--QQLKME---PFSED---EDADTKAQILCEPEID---V 106
            :||:|..||..|..|..:|..||..|  |.|.::   .:|||   ...|.:.|:|.||..:   |
  Fly    66 ICTECCSQLESFHNFWKLVELKQTTLCSQFLAIDCDVNWSEDGSETQLDAQPQLLLEPAEEPKVV 130

  Fly   107 SPAAADNEEC------------------------------------------------------- 116
            :|..|:...|                                                       
  Fly   131 TPTTANKFPCMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEMAFRCRSNMYTHVKSKHTTQWLK 195

  Fly   117 ----------------------------------------------NEIDGDASSNSRSSSIRTT 135
                                                          |.::..|::...||:..||
  Fly   196 AREERDAAKSNQNHTTPEETAPAVLVPVPAPAPALASAPASSASPGNTVNPAATATPASSATPTT 260

  Fly   136 SLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAEGEGDPESRSSNSREMD 200
            :|....|||| ....:||.:|...:.........|||                |.|.|..||...
  Fly   261 NLAAAPLPSP-PTVQQLPLSVIKSQPSEAMNLTITKT----------------PPSGSRGSRNRS 308

  Fly   201 SYIALHGRLECCICGG----DEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHN 261
            |....|...:.....|    ||..|                      |:|.|:..|.:       
  Fly   309 SRRKTHSPKKVQHTEGSDVSDEDSP----------------------QKRLKENELIL------- 344

  Fly   262 DPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQ 326
             .||   ...:..:|:..|     |..:|....     |...:|.....|        ||:..||
  Fly   345 -ANY---NAVAAAVVAAAS-----LTGNPPGQP-----DSLQQRLCASLL--------QQQHQEQ 387

  Fly   327 CKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVH--REGSQLPEVQC 389
                         |...|..|...|.......:......|...::.|....|  .|..:.|....
  Fly   388 -------------LFAVMSATAAAAAAVGTSSATTTTTTTTGTMMAHPYGNHPPSETDKRPAAPL 439

  Fly   390 QECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKE 454
            |               ..:|....|:   .|..||...|...:..:..:|       .|..|.|.
  Fly   440 Q---------------AVIHAAPVSI---ICPNCGELPGQNHRCLSKPKY-------ACDVCGKS 479

  Fly   455 FKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMH------------AAQVAALQQQ 507
            ||..|.||||.|||||..|:.||||...|::..||:.|.::.|            ||:....:|.
  Fly   480 FKMKRYLEEHFATHTGVKLHTCAFCPTEFRSKSNMYHHTKRKHKAEWERSRATRSAAKAGVQEQM 544

  Fly   508 KKVPPSK 514
            :...||:
  Fly   545 QHTNPSQ 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 34/93 (37%)
C2H2 Zn finger 268..289 CDD:275368 3/20 (15%)
C2H2 Zn finger 299..319 CDD:275368 3/19 (16%)
C2H2 Zn finger 327..348 CDD:275368 2/20 (10%)
C2H2 Zn finger 357..376 CDD:275368 2/18 (11%)
C2H2 Zn finger 389..409 CDD:275368 1/19 (5%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
C2H2 Zn finger 448..468 CDD:275368 11/19 (58%)
C2H2 Zn finger 476..494 CDD:275368 8/17 (47%)
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 33/91 (36%)
C2H2 Zn finger 140..160 CDD:275368 1/19 (5%)
COG4049 149..204 CDD:226535 0/54 (0%)
C2H2 Zn finger 168..186 CDD:275368 0/17 (0%)
C2H2 Zn finger 473..493 CDD:275370 11/19 (58%)
C2H2 Zn finger 501..522 CDD:275370 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.