DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and ZNF707

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001094068.1 Gene:ZNF707 / 286075 HGNCID:27815 Length:371 Species:Homo sapiens


Alignment Length:353 Identity:85/353 - (24%)
Similarity:133/353 - (37%) Gaps:65/353 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 PKTQAVKAKARTKTHKAEADE----DEDAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQ 219
            |:.|||:...|....|: ||.    |..|........|...:||..|:     |....:...|.|
Human    74 PEFQAVQRGPRPGARKS-ADPKRPCDHPAWAHKKTHVRRERAREGSSF-----RKGFRLDTDDGQ 132

  Fly   220 FPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVH 284
            .|..|..:...:                               |..|.|::.:::...|..    
Human   133 LPRAAPERTDAK-------------------------------PTAFPCQVLTQRCGRRPG---- 162

  Fly   285 MLRFHPNKD---DLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMR- 345
              |....|.   :|||.|..|.|..|....|..|..||...:..:|..|.::||.|.:|:.|.: 
Human   163 --RRERRKQRAVELSFICGTCGKALSCHSRLLAHQTVHTGTKAFECPECGQTFRWASNLQRHQKN 225

  Fly   346 RTHDPAFVPFICDSCGAKFKTKQNLLVHKR--TVHREGSQLPEVQCQECQVWLSDENSLRKHMYM 408
            .|.:.   ||.|::||..|..|..|..|::  |.||..|      |.:|......:::|.:|..:
Human   226 HTREK---PFCCEACGQAFSLKDRLAQHRKVHTEHRPYS------CGDCGKAFKQKSNLLRHQLV 281

  Fly   409 HLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHTGQDL 473
            |   ...|.:.|..||....::..|:.|.|.|..::.:.|..|.|.|:..:....|...|..:..
Human   282 H---TGERPFYCADCGKAFRTKENLSHHQRVHSGEKPYTCAECGKSFRWPKGFSIHRRLHLTKRF 343

  Fly   474 YECAFCERTFKNSGNMHKHRRQMHAAQV 501
            |||..|.:.|::.|...:|:|.....:|
Human   344 YECGHCGKGFRHLGFFTRHQRTHRHGEV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368 3/20 (15%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..348 CDD:275368 7/21 (33%)
C2H2 Zn finger 357..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 389..409 CDD:275368 4/19 (21%)
C2H2 Zn finger 420..440 CDD:275368 6/19 (32%)
C2H2 Zn finger 448..468 CDD:275368 5/19 (26%)
C2H2 Zn finger 476..494 CDD:275368 5/17 (29%)
ZNF707NP_001094068.1 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..143 19/74 (26%)
C2H2 Zn finger 178..198 CDD:275368 6/19 (32%)
COG5048 <187..366 CDD:227381 52/190 (27%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
zf-H2C2_2 218..242 CDD:290200 8/26 (31%)
C2H2 Zn finger 234..254 CDD:275368 7/19 (37%)
zf-C2H2 260..282 CDD:278523 5/27 (19%)
C2H2 Zn finger 262..282 CDD:275368 4/19 (21%)
zf-H2C2_2 274..299 CDD:290200 7/27 (26%)
C2H2 Zn finger 290..310 CDD:275368 6/19 (32%)
zf-H2C2_2 302..325 CDD:290200 7/22 (32%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)
C2H2 Zn finger 346..366 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.