DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and mld

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster


Alignment Length:517 Identity:117/517 - (22%)
Similarity:182/517 - (35%) Gaps:143/517 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QPVPSNLAELIE--KHLQLVLLPNDGVSKSLCTQCWQQLADFEQFCAMVMKKQLGLQQLKMEPFS 87
            |..|....|:::  :.||:.:.|             ||....:|    |::.|...||..|:|.|
  Fly  1517 QQQPQLQQEVLQQVQQLQVQVQP-------------QQHQQHQQ----VLQVQQPQQQPLMQPQS 1564

  Fly    88 E-------DEDADTKAQILCEPEIDVSPAAADNEECNEIDGDASSNSRSSSIRTTSL-------- 137
            .       .....|..:|||.|         |.|:|.  .|.:.:|.:...::|...        
  Fly  1565 PHPSTVEMQASPTTPRKILCCP---------DCEDCT--SGHSHANEQFEELQTLQAPPTVLTPP 1618

  Fly   138 ---------------REMRLPSP-------------IRRR---------MRLPRAVTAPKTQAVK 165
                           :.:.:|||             .|:|         :.|...|.:|...: .
  Fly  1619 STIVSVPSPQPMVYSQHITMPSPEQSEPDSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSS-S 1682

  Fly   166 AKARTKTHKAEADEDEDAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHF 230
            ..:.|..|...|.....|.....|....:::.::......|   .|..|  :|:|.|...:|:|.
  Fly  1683 PSSSTVDHIPPASPATPASPAPPPSPAVASTVQVSELRTSH---HCLYC--EERFTNEISLKKHH 1742

  Fly   231 RNHHQSLGYV--VC--CQRRYKKRALYVDHLHMHN-DPNYFRCKICSKQLVSRISYDVHMLRFH- 289
            :..|.:|..:  ||  |:|.|:.|.....|:..|: :...:.|.||..:........:|.:..| 
  Fly  1743 QLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHL 1807

  Fly   290 ---PNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMRRTHDPA 351
               |:      .||:|.|:|..:..|..|.:.| .|...||..|||:|....:||.| ||||...
  Fly  1808 LSKPH------TCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKH-RRTHSEM 1864

  Fly   352 FVPFICDSCGAKFKTKQNLLVHKRT-----VHRE---GSQLPEVQCQECQVWLSDENSLRKHMYM 408
            |  :.|..|.:.|....|...|.:|     |.|.   .|:.|           |:.||       
  Fly  1865 F--YKCKFCPSSFMRFTNFRAHMKTHLPLGVFRNEDAASKSP-----------SNNNS------- 1909

  Fly   409 HLDAASLRQ--WKCEQCGLEKGSRAKLAAHIRYHHPKEY-HKCTHCAKEFKSSRSLEEHTAT 467
            |..:..|..  ...|:..|...|.   ..|: ||.|.|| :....||   .:|.:||.:..|
  Fly  1910 HASSDKLENPATPIEETPLTPMSS---GGHL-YHSPDEYPNSVESCA---GNSVALESYATT 1964

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 12/57 (21%)
C2H2 Zn finger 268..289 CDD:275368 4/20 (20%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 10/20 (50%)
C2H2 Zn finger 357..376 CDD:275368 5/18 (28%)
C2H2 Zn finger 389..409 CDD:275368 3/19 (16%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
C2H2 Zn finger 448..468 CDD:275368 6/20 (30%)
C2H2 Zn finger 476..494 CDD:275368
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 7/22 (32%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 4/20 (20%)
C2H2 Zn finger 1814..1834 CDD:275368 7/19 (37%)
zf-C2H2 1839..1861 CDD:278523 11/22 (50%)
C2H2 Zn finger 1841..1861 CDD:275368 10/20 (50%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.