DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and hinf-1

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_493579.2 Gene:hinf-1 / 173348 WormBaseID:WBGene00009553 Length:541 Species:Caenorhabditis elegans


Alignment Length:460 Identity:97/460 - (21%)
Similarity:164/460 - (35%) Gaps:112/460 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DASSNSRSSSIRTTSLREMRLPSPIRRRMRL----PRAVTAPKTQAVKAKARTKTHKAEADE-DE 181
            |:.|.....|.||        |:||....|.    |||            :|..::.:|:.| .|
 Worm    71 DSDSQDSVDSFRT--------PAPISSATRFSTHTPRA------------SRASSNDSESGELSE 115

  Fly   182 DAEGEGDPES---RSSNSREMDSYIALHGRLECCICGG-------DEQFPNFAEMKRHFRNHHQS 236
            :......|.:   |||:..::.:::.|.|:   |:...       |..|.:.:.::...:|.:. 
 Worm   116 EVMNHWLPMTWCERSSDDPQVFTFVCLWGQ---CVSSSSSKDEFVDHLFGHVSVIEEGVQNGNH- 176

  Fly   237 LGYVVCCQRRYKKRALYVDHLHMH-------------------NDPNYFRCKICSKQLVSRISYD 282
            :..|.|..|...|....:..||.|                   ...:|...:.|..:..:.|:|:
 Worm   177 MNTVQCKVRGCNKHLDSIFQLHRHVSMHVFQADCQQKGSEALIEKEDYIGIESCGFEPCTNINYE 241

  Fly   283 VHML------------------------------------RFHPNKDDLSFAC--DQCSKRFSKQ 309
            ..:|                                    .|......:.|.|  ..|::....:
 Worm   242 GMLLNCQWEDCGMPFNSLTELFDHVGHHIDGVGDVDRIQQNFSNGDKKVVFPCKWTACTQVADSK 306

  Fly   310 FLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLH-MRRT---HDPAFV-PFICDSCGAKFKTKQN 369
            ..|..|:|.|..|:...|..|.|.|.....|..| :|||   .:|... |::|..|..:|.|::.
 Worm   307 ANLRRHARHHSGEKVLACPFCARFFSRRDKLYDHCLRRTILMKNPEMEDPYLCKLCQKRFGTEKA 371

  Fly   370 LLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLA 434
            |.:|. |.|     |..:.|..|.:.|.....|.:|: |...:...:.:||:.|.....:.::|.
 Worm   372 LCMHV-TRH-----LVSLTCPLCSLGLGCRAELHRHL-MTKHSRRSKDFKCDTCSKLFFTESELN 429

  Fly   435 AHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHT---GQDLYECAFCERTFKNSGNMHKHRRQM 496
            .|..||....| .|.||.::||..:.|.:|...|.   ....|.|..|:||:.....:.:|..:.
 Worm   430 RHAVYHSDVMY-SCKHCPEKFKWKKQLMKHMKEHDENFNPSPYTCHLCDRTYTTGFALGRHLTRQ 493

  Fly   497 HAAQV 501
            |..|:
 Worm   494 HRLQI 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368 4/56 (7%)
C2H2 Zn finger 299..319 CDD:275368 5/21 (24%)
C2H2 Zn finger 327..348 CDD:275368 9/24 (38%)
C2H2 Zn finger 357..376 CDD:275368 6/18 (33%)
C2H2 Zn finger 389..409 CDD:275368 5/19 (26%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 5/17 (29%)
hinf-1NP_493579.2 C2H2 Zn finger 299..316 CDD:275368 4/16 (25%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..379 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..406 CDD:275368 6/21 (29%)
C2H2 Zn finger 415..435 CDD:275368 4/19 (21%)
C2H2 Zn finger 442..462 CDD:275368 7/19 (37%)
C2H2 Zn finger 473..494 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.