DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and STP4

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:365 Identity:67/365 - (18%)
Similarity:116/365 - (31%) Gaps:116/365 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LAEIEQFCSM--VAEKQ-----RSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEG 118
            |..|..|.::  |||::     .|||.:            .|.|.|..|:               
Yeast   132 LPPISSFTNLITVAEREFNGRSNSLHAN------------FTSPVPRTVL--------------- 169

  Fly   119 DDIKDH-----ILCEPVIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRP- 177
                ||     ..|.|          .::....|..|     |.|.:.:...|..|...||.:. 
Yeast   170 ----DHHRHELTFCNP----------NNTTGFKTITP-----SPPTQHQSILPTAVDNVPRSKSV 215

  Fly   178 RKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEE-- 240
            ....:.....:|.::.::::..:.:..:.|....|........|.|:..:|.....:..:.:|  
Yeast   216 SSLPVSGFPPLIVKQQQQQQLNSSSSASALPSIHSPLTNEHTSRYSSSLKDSAKITKQRKKKECP 280

  Fly   241 -----------DVGGELTPDADEQPKPRGKRGRPKTKKLVT-----------------------A 271
                       .....|||:......|..:||..:...|:.                       |
Yeast   281 ICHNFYANLSTHKSTHLTPEDRPHKCPICQRGFARNNDLIRHKKRHWKDEFMQIYARESDNNSGA 345

  Fly   272 DDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNR- 335
            ||.|||:.......| .:.:|.:||:...:    ...|...|.||..::::    |..||..|. 
Yeast   346 DDQDDTARTSANNDS-DDSNDKLAASSSSE----ETKLLKKNQLKSLYKIK----GAFKCPYNST 401

  Fly   336 ----------YKKRTLYVDHLHCHKDPQYFSCQSCRKNFL 365
                      :|.|:||.:.::||:...:..|.:. ||.|
Yeast   402 LINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTF-KNHL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 6/23 (26%)
C2H2 Zn finger 332..349 CDD:275368 5/27 (19%)
C2H2 Zn finger 357..378 CDD:275368 4/9 (44%)
C2H2 Zn finger 388..408 CDD:275368
C2H2 Zn finger 417..438 CDD:275368
C2H2 Zn finger 447..465 CDD:275368
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
STP4NP_010235.1 COG5048 14..442 CDD:227381 67/365 (18%)
C2H2 Zn finger 279..296 CDD:275368 0/16 (0%)
C2H2 Zn finger 306..326 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.