DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and STP3

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:43/202 - (21%)
Similarity:62/202 - (30%) Gaps:62/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 CNNRYKKRTLYVDHLHCHKDPQ--YFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEAR 394
            |.|.|...|   .|...|..|:  ...|..|.:.|...|..:.|..|  ..:.|::.|..:    
Yeast   147 CRNFYANLT---THKATHLTPEDRPHKCPICHRGFARNNDLLRHKKR--HWKDEILSQSGV---- 202

  Fly   395 FAKKFLLTMHLKGHKGTERPEVCDTCSK---------------------TFRTKF-------ELS 431
                  |:.|..|..|:..|...||..|                     ||:..|       ::.
Yeast   203 ------LSNHNDGKGGSVSPNDDDTHEKMTPMNSVTDYAQLKSLHQIKGTFKCPFNSTLIQLDMD 261

  Fly   432 AHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGP---------VAEVQCTLCGR---- 483
            .:..::...:|....|...|...|.. .|..|.||||.:.|         |...:|..||.    
Yeast   262 MYPYKLKPLNFETSNCHQTGVFSRCD-TFKNHLKALHFEYPPGTKKKDRNVVPGRCKHCGLKFEN 325

  Fly   484 ---WLRD 487
               ||.:
Yeast   326 VDVWLNE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 5/16 (31%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 2/19 (11%)
C2H2 Zn finger 417..438 CDD:275368 6/48 (13%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 5/17 (29%)
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
STP3NP_013479.3 COG5048 <137..295 CDD:227381 32/163 (20%)
C2H2 Zn finger 144..161 CDD:275368 5/16 (31%)
C2H2 Zn finger 171..191 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.