DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and ZNF212

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_036388.2 Gene:ZNF212 / 7988 HGNCID:13004 Length:495 Species:Homo sapiens


Alignment Length:428 Identity:85/428 - (19%)
Similarity:134/428 - (31%) Gaps:138/428 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDD---------------QDGDEDEEDE 239
            |..|....:.|...:..|.:......:.||.....|..::               |:....:|..
Human   163 KELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGP 227

  Fly   240 EDVGGELTPDADEQ----PKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKL 300
            .|:.||.:..|:||    |:.....|...:..|:.....|.|.|.||            .:.|..
Human   228 ADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPV------------GSRVPS 280

  Fly   301 DCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFL 365
            .......|.:     |.|.:|:.|                                 |.|     
Human   281 SSRTVGCPKQ-----KSHRQVQLD---------------------------------QEC----- 302

  Fly   366 NRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKG-----TERPEVCDTCSKTFR 425
               .|.:.:.:..|:.    ::|:.||..|..|..|..||:.|.|     .|.||      ::.|
Human   303 ---GQGLKLKKDTSRP----YECSECEITFRYKQQLATHLRSHSGWGSCTPEEPE------ESLR 354

  Fly   426 TKFELSAHVK--RMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDE 488
            .:..|....|  ::|.       ||:|...|..|.:.:.|::....:||.|       |:.:::.
Human   355 PRPRLKPQTKKAKLHQ-------CDVCLRSFSCKVSLVTHQRCHLQEGPSA-------GQHVQER 405

  Fly   489 RSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEH 553
            .|                         .:|..||..|:.:..|.....|..|.|.|..|..|..|
Human   406 FS-------------------------PNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRH 445

  Fly   554 MATHTGIDLYQCQFCTRTF--KSHANMHNHKKKMHPND 589
            ...|||...|.|..|.::|  |.|...|   :|:|..:
Human   446 QRIHTGERPYSCTECEKSFVQKQHLLQH---QKIHQRE 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 0/16 (0%)
C2H2 Zn finger 357..378 CDD:275368 3/20 (15%)
C2H2 Zn finger 388..408 CDD:275368 8/19 (42%)
C2H2 Zn finger 417..438 CDD:275368 3/22 (14%)
C2H2 Zn finger 447..465 CDD:275368 6/17 (35%)
C2H2 Zn finger 478..498 CDD:275368 2/19 (11%)
C2H2 Zn finger 509..529 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..583 CDD:275368 6/19 (32%)
ZNF212NP_036388.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
KRAB_A-box 142..180 CDD:143639 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..290 7/37 (19%)
C2H2 Zn finger 318..338 CDD:275370 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 337..361 7/29 (24%)
COG5048 <367..479 CDD:227381 36/153 (24%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 429..449 CDD:275368 7/19 (37%)
zf-C2H2 429..449 CDD:306579 7/19 (37%)
zf-H2C2_2 441..466 CDD:316026 9/24 (38%)
C2H2 Zn finger 457..477 CDD:275368 7/22 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..495 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.