DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and E4f1

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001171975.1 Gene:E4f1 / 681359 RGDID:1596731 Length:783 Species:Rattus norvegicus


Alignment Length:612 Identity:127/612 - (20%)
Similarity:201/612 - (32%) Gaps:197/612 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQRE 218
            |.|:.||      |.|....|.:...|||:   ..::.|.:|...              ||.|..
  Rat    47 PFSEEDE------DDVHRCGRCQVEFTALE---DFVQHKIQKTCH--------------RAPQEA 88

  Fly   219 LKRSSA-----GAE----DDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTADD- 273
            |..:||     |.|    ..::|.|:......:..|.|..|::........|....|:::.|.: 
  Rat    89 LPTTSAATSLLGQEVVPTAAEEGPEEPITVAHIVVEATSLAEDMSHAPDLVGSGHIKEVIVAAEA 153

  Fly   274 ---NDDTSEVP--VKRSSIKEMDDYIAANVKL--------DCAICAAPLEDFNDLKRHF-----R 320
               :.:.:|.|  .....:..:.:...|.|||        .|.:|....:..:.||.|.     |
  Rat   154 EPGDGEMAEAPGSPNHQELGLIGEGEQAQVKLLVNKEGRYVCMLCHKTFKTGSILKAHMVTHSSR 218

  Fly   321 VEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNF-----LNRN------------ 368
            .:|:|    |.|...::.:...:.|...|.|.:.:.|..|.|:|     |.|:            
  Rat   219 KDHEC----KLCGASFRTKGSLIRHHRRHTDERPYKCAKCGKSFRESGALTRHLKSLTPCTEKIR 279

  Fly   369 -------------------------------------SQVMHML---------RFHSQQQE---- 383
                                                 |.|:|::         ..|.|.||    
  Rat   280 FSISKDTAVGKEEVPAGSSASTVGTVTSSVAGEPMETSPVIHLVTDAKGTVIHEVHVQMQELPLG 344

  Fly   384 ---LVHQCAICE-----ARFAKKFLLTMHLK----------GHKGTERP---------------- 414
               |..:.|.||     ...:::.||...::          |.:.|.:|                
  Rat   345 MKALTPESADCEELPCSRENSRENLLHQAMQNSGIVLDRVAGEESTLQPAPPSGSSPQSLGDGPS 409

  Fly   415 -----EV-------------------CDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFR 455
                 ||                   |..||:||.:...|.|| ||.|... .|..|..||..| 
  Rat   410 ELPLLEVEQIETQVASEAATVPRTHPCSQCSETFPSAATLEAH-KRGHIGP-RPFTCTQCGKAF- 471

  Fly   456 SKANFLIHKKALHPDGPVAE--VQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSS 518
            .|| :|:.|   |.:..|.|  .:|..||:..:....:|.|...|.|   :..:.|..|.....:
  Rat   472 PKA-YLLKK---HQEVHVHERRFRCGDCGKLYKTIAHVRGHRRVHSD---ERPFPCPQCGKRYKT 529

  Fly   519 RAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKK 583
            :.|...|.|.|...|.|.|..|.:.|:...:|..|:..|||...::|..|.|.|..|..::.|.:
  Rat   530 KNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLR 594

  Fly   584 K-----MHPNDWVRKYSQPSSSITSTA 605
            .     :...:.:.....||::.|..|
  Rat   595 TKGGCLLEVEELLVSEESPSAAATVLA 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 9/83 (11%)
C2H2 Zn finger 388..408 CDD:275368 5/34 (15%)
C2H2 Zn finger 417..438 CDD:275368 10/20 (50%)
C2H2 Zn finger 447..465 CDD:275368 7/17 (41%)
C2H2 Zn finger 478..498 CDD:275368 5/19 (26%)
C2H2 Zn finger 509..529 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..583 CDD:275368 6/17 (35%)
E4f1NP_001171975.1 COG5048 193..594 CDD:227381 89/414 (21%)
C2H2 Zn finger 195..215 CDD:275368 5/19 (26%)
zf-C2H2 221..243 CDD:278523 5/25 (20%)
C2H2 Zn finger 223..243 CDD:275368 4/23 (17%)
zf-H2C2_2 235..258 CDD:290200 6/22 (27%)
C2H2 Zn finger 251..269 CDD:275368 6/17 (35%)
C2H2 Zn finger 436..456 CDD:275368 10/20 (50%)
zf-H2C2_2 449..471 CDD:290200 10/23 (43%)
zf-C2H2 462..484 CDD:278523 9/26 (35%)
C2H2 Zn finger 464..484 CDD:275368 9/24 (38%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
zf-H2C2_2 504..529 CDD:290200 6/27 (22%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 548..568 CDD:275368 5/19 (26%)
zf-H2C2_2 560..584 CDD:290200 8/23 (35%)
C2H2 Zn finger 576..595 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.