DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11696 and SNAI1

DIOPT Version :9

Sequence 1:	NP_572731.1	Gene:	CG11696 / 32104	FlyBaseID:	FBgn0030314	Length:	664	Species:	Drosophila melanogaster
Sequence 2:	NP_005976.2	Gene:	SNAI1 / 6615	HGNCID:	11128	Length:	264	Species:	Homo sapiens

Alignment Length:	116	Identity:	35/116 - (30%)
Similarity:	49/116 - (42%)	Gaps:	5/116 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   495 LARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTG 559
            |:...|......:.|..||.|..|..||..|:|.|  .....|..|.|.|..|..|..|:.||||
Human   142 LSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSH--TLPCVCGTCGKAFSRPWLLQGHVRTHTG 204

  Fly   560 IDLYQCQFCTRTFKSHANMHNHKKKMHPNDWVRKYSQPSSSITSTAAPLAH 610
            ...:.|..|:|.|...:|:..|   :..:..|:||...:.:.|.:...|.|
Human   205 EKPFSCPHCSRAFADRSNLRAH---LQTHSDVKKYQCQACARTFSRMSLLH 252

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11696	NP_572731.1	zf-AD	2..78	CDD:285071
		C2H2 Zn finger	332..349	CDD:275368
		C2H2 Zn finger	357..378	CDD:275368
		C2H2 Zn finger	388..408	CDD:275368
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	447..465	CDD:275368
		C2H2 Zn finger	478..498	CDD:275368	1/2 (50%)
		C2H2 Zn finger	509..529	CDD:275368	9/19 (47%)
		C2H2 Zn finger	537..557	CDD:275368	7/19 (37%)
		C2H2 Zn finger	565..583	CDD:275368	6/17 (35%)
SNAI1	NP_005976.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..27
		SNAG domain. /evidence=ECO:0000305\|PubMed:20389281, ECO:0000305\|PubMed:21300290	1..20
		Required and sufficient for interaction with KDM1A. /evidence=ECO:0000269\|PubMed:20389281, ECO:0000269\|PubMed:23721412	2..7
		LATS2 binding	10..40
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	86..115
		Destruction motif	95..100
		Required for FBXL14-triggered degradation	120..151		2/8 (25%)
		Required for nuclear localization and interaction with KPNB1, NOTCH1 and PARP1. /evidence=ECO:0000269\|PubMed:21577210, ECO:0000269\|PubMed:22128911	151..264		33/107 (31%)
		C2H2 Zn finger	156..176	CDD:275368	9/19 (47%)
		C2H2 Zn finger	182..202	CDD:275368	7/19 (37%)
		zf-H2C2_2	195..218	CDD:404364	9/22 (41%)
		zf-C2H2	208..230	CDD:395048	6/24 (25%)
		C2H2 Zn finger	210..230	CDD:275368	6/22 (27%)
		C2H2 Zn finger	238..255	CDD:275368	3/15 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100