DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and znf367

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001017726.2 Gene:znf367 / 550421 ZFINID:ZDB-GENE-050417-231 Length:316 Species:Danio rerio


Alignment Length:220 Identity:51/220 - (23%)
Similarity:71/220 - (32%) Gaps:73/220 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 AEVQCTLCGRWLRDERSLRKHLARHDD-----RDGD---TKYRCLLCNAEKSSRAALSSHMRYHH 530
            ||.....|...|:|  .:|:...|.|.     .:|:   ::.||.:||.......:|.:|.|.|.
Zfish    82 AEADPLSCPEHLKD--GIRRGRPRADTVRELINEGENSTSRIRCNICNRVFPREKSLQAHKRTHT 144

  Fly   531 SAKRHKCSL--CDKEFKLPRALAEHMATHTGIDLYQC--QFCTRTFKSHANMHNHK------KKM 585
            ..:.:.|..  |.|.|.....|..|...|||...:.|  :.|...| :|||.|..|      |:.
Zfish   145 GERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSEKACGSRF-THANRHCAKHPYARLKRE 208

  Fly   586 HPN---------------DWVRKYSQPSSSITSTAAPLAHPNHPNQPAPPAAAPTNLAGHMLPPL 635
            .|.               :|:.||.|              ......|.|..|.|.|         
Zfish   209 EPTGGPGKSQGADNKAVAEWLTKYWQ--------------TREQRSPVPGKAKPQN--------- 250

  Fly   636 GGIAKSLIE----------IPDTEG 650
                ||.:|          :|..||
Zfish   251 ----KSPLEDQEQQDPLDFLPSDEG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368
C2H2 Zn finger 357..378 CDD:275368
C2H2 Zn finger 388..408 CDD:275368
C2H2 Zn finger 417..438 CDD:275368
C2H2 Zn finger 447..465 CDD:275368
C2H2 Zn finger 478..498 CDD:275368 4/19 (21%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 6/21 (29%)
C2H2 Zn finger 565..583 CDD:275368 8/25 (32%)
znf367NP_001017726.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..97 5/16 (31%)
COG5048 115..>182 CDD:227381 17/66 (26%)
C2H2 Zn finger 123..143 CDD:275368 6/19 (32%)
C2H2 Zn finger 151..173 CDD:275368 6/21 (29%)
C2H2 Zn finger 181..200 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..294 12/65 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.