DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and wek

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster


Alignment Length:619 Identity:134/619 - (21%)
Similarity:205/619 - (33%) Gaps:204/619 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CRLCLEDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIEQF 67
            ||||..|     .:..:.........|.:::..:..:.|   |...:.:.||..|:..:.::..|
  Fly    12 CRLCARD-----DVVYKVRERDDDLVRIISKCFDVEMTL---EEPELGSMLCEECYSVIGQLITF 68

  Fly    68 CSMVAEKQRSLHRSLQLKTELPELPELTEPEPA--LVVWNTESPIEPKLSYEGDDIKDHILCEPV 130
            ...|::.|           .:.||...:||:.:  |.....|..:.|             .|:..
  Fly    69 SDSVSKVQ-----------AIFELLRHSEPQDSQDLDALRLEYGLPP-------------ACKQD 109

  Fly   131 IDALSAGDEKD----------SDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQT 185
            ::.|...|.:|          ||:..:..||||.::            |:.|..       |:|.
  Fly   110 LEFLDIDDTEDRCSLVEELTISDHSTSPSPDFEAQT------------VRTRAN-------LKQC 155

  Fly   186 HQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSS----AGAEDDQDG--DEDEEDEEDVGG 244
            :     ...|......|.|.|:..:.||.:|...||:|    |...||::.  ||||        
  Fly   156 N-----SDPKVLASPTASIPEVETKRSRRQQFAAKRNSKVYTATESDDEEAILDEDE-------- 207

  Fly   245 ELTPDADEQPKPRGKRGRPK-TKKLVTADDNDD-TSEVPVKRSSIKEMDDYIAANVKLDCAICAA 307
                 |...|..:.|||||| :.|....||:|: ||..|...:..|:.|                
  Fly   208 -----AVSPPPLKRKRGRPKGSGKQKNVDDSDNVTSREPDDNAKSKQDD---------------- 251

  Fly   308 PLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVM 372
                                                                        .:..:
  Fly   252 ------------------------------------------------------------KTSEL 256

  Fly   373 HMLRFHSQQQELV-HQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKR 436
            .|....||....| :.|.||...|.....|..|.....|..:..|||.|.|..:|...|..| :.
  Fly   257 SMSPHGSQSSNFVDYPCKICNETFMSFMALRRHKHDMHGGPKKYVCDHCGKGLKTFTSLVEH-QL 320

  Fly   437 MHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDR 501
            :|..: .|.||.:|...|::||.                               ||.|...|   
  Fly   321 VHTEE-KPCICPVCNAGFKNKAR-------------------------------LRVHSQTH--- 350

  Fly   502 DGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQ 566
             |:.|:.|.:|..:..:||.|:.|...|...:|.||.:|....|...||..|:..|||:..|.|:
  Fly   351 -GEPKFECNVCGKKLQTRAILNKHKYVHTDERRFKCEVCGSGCKNSTALKIHLLGHTGLRPYVCK 414

  Fly   567 FCTRTFKSHANMHNHKKKMHPNDWVRKYSQPSSS 600
            :|.:.|.|:.|..:||.|.|| :...|..:..||
  Fly   415 YCGKAFASNTNCRSHKWKKHP-ELASKEDETESS 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 14/74 (19%)
C2H2 Zn finger 332..349 CDD:275368 0/16 (0%)
C2H2 Zn finger 357..378 CDD:275368 1/20 (5%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 3/19 (16%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 6/17 (35%)
wekNP_001260472.1 zf-AD 11..80 CDD:214871 14/86 (16%)
C2H2 Zn finger 273..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 7/20 (35%)
C2H2 Zn finger 330..350 CDD:275368 8/50 (16%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 10/24 (42%)
C2H2 Zn finger 413..429 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.