DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and sens

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster


Alignment Length:460 Identity:94/460 - (20%)
Similarity:152/460 - (33%) Gaps:138/460 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 RQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRP---KTKKLVTADDND- 275
            ::.||:.::......||..|.:||                       .|   .||:.:|:||:: 
  Fly   111 KEHELQMNNNNENSKQDYQEQDED-----------------------MPLNLSTKERITSDDSNR 152

  Fly   276 ----DTSEVPVKRSSIKEMDD-------------YIAANVKLD------------------CAIC 305
                .:|....:.||..|::.             ..|.|:|..                  .::|
  Fly   153 DQYHSSSNNSSRSSSSSEVEQLHPMTSLNVTPPPLSAVNLKSSSTPQQQRQRSQGNIIWSPASMC 217

  Fly   306 ---------AAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCR 361
                     ...:|:..|     ..||.....|:  ..:|::||..:.           |.||..
  Fly   218 ERSARREQYGLKMEEQGD-----EEEHQVDPIVR--KFKYERRTASIS-----------SLQSPI 264

  Fly   362 KNFLNRNSQVMHMLRFHSQQQEL-VHQCAICEARFAKKF-LLTMHLKGHKGTERPEVCDTCSKTF 424
            .:.....|..:..|.|...||:| .|:.|.......... |||.|||  ..:|:|:   ...:..
  Fly   265 SSLSAPASNAVQDLEFEVAQQQLYAHRSAFMAGLTGNNLELLTQHLK--LKSEQPQ---QQQQQH 324

  Fly   425 RTKFE-------LSAHVKRMHAADF--------TPIICDICGTHFRSKANFLIHKKALHPDGPVA 474
            |.|.|       .:|.:..:.||:|        .|........|.:.:.....|::. |||....
  Fly   325 RIKDEQQQDNRSAAALMNLVAAAEFGYMRNQHQQPQQQQQQQLHHQQQPQQHQHQQQ-HPDSTAT 388

  Fly   475 EV-----------------------QCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEK 516
            :|                       ||..||:..:...:|..||..|.|   ...|.|..|....
  Fly   389 DVARRSSSSSSYQGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSD---TRPYPCQYCGKRF 450

  Fly   517 SSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNH 581
            ..::.:..|...|...|.|||::|.|.|.....|..||..|||...:.|..|.::|:...::..|
  Fly   451 HQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRH 515

  Fly   582 KKKMH 586
            ::..|
  Fly   516 RESRH 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 3/16 (19%)
C2H2 Zn finger 357..378 CDD:275368 4/20 (20%)
C2H2 Zn finger 388..408 CDD:275368 7/20 (35%)
C2H2 Zn finger 417..438 CDD:275368 4/27 (15%)
C2H2 Zn finger 447..465 CDD:275368 2/17 (12%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..529 CDD:275368 3/19 (16%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..583 CDD:275368 4/17 (24%)
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 7/21 (33%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
COG5048 423..>497 CDD:227381 23/76 (30%)
zf-H2C2_2 428..452 CDD:290200 8/26 (31%)
C2H2 Zn finger 443..463 CDD:275368 3/19 (16%)
zf-H2C2_2 455..480 CDD:290200 9/24 (38%)
C2H2 Zn finger 471..491 CDD:275368 7/19 (37%)
C2H2 Zn finger 499..516 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.