Sequence 1: | NP_572731.1 | Gene: | CG11696 / 32104 | FlyBaseID: | FBgn0030314 | Length: | 664 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
Alignment Length: | 342 | Identity: | 73/342 - (21%) |
---|---|---|---|
Similarity: | 116/342 - (33%) | Gaps: | 95/342 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 300 LDCAICAA--------PLE-DFND-LKRHFRVE---------HDCTGYVKCCNNRYKKRTLYVDH 345
Fly 346 LHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKG 410
Fly 411 TERP-----EVCDTCSKTFRTKFELSAHVKRM------------------------------HAA 440
Fly 441 DFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDT 505
Fly 506 KYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTR 570
Fly 571 TFKS--HANMH--NHKK 583 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11696 | NP_572731.1 | zf-AD | 2..78 | CDD:285071 | |
C2H2 Zn finger | 332..349 | CDD:275368 | 3/16 (19%) | ||
C2H2 Zn finger | 357..378 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 388..408 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 417..438 | CDD:275368 | 2/50 (4%) | ||
C2H2 Zn finger | 447..465 | CDD:275368 | 4/17 (24%) | ||
C2H2 Zn finger | 478..498 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 509..529 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 537..557 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 565..583 | CDD:275368 | 8/21 (38%) | ||
CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | 14/44 (32%) |
C2H2 Zn finger | 180..200 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 193..217 | CDD:290200 | 5/26 (19%) | ||
COG5048 | 201..>258 | CDD:227381 | 14/62 (23%) | ||
C2H2 Zn finger | 208..228 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 221..244 | CDD:290200 | 7/25 (28%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 251..273 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 264..284 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 277..301 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |