DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG4424

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:470 Identity:97/470 - (20%)
Similarity:144/470 - (30%) Gaps:183/470 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ICRLCLEDAE-HGVPIFGQEPPMGQPAHRQLAELIER---HLLLVLAENDVVSTCLCNRCWRQLA 62
            :||.||:|.| |.|.|| |......|....|.:.||.   ..:...|:.:|:.|.:|.||...|.
  Fly    10 LCRTCLQDGEAHMVSIF-QTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPTRICLRCKAFLT 73

  Fly    63 EIEQFCSMVAEKQRSLHRSLQLKTEL-------------PELP------ELTEPEPALV---VWN 105
            ...:| ..:.::.....|...:|..:             |..|      :|..||..::   ||:
  Fly    74 LAHKF-RQICQRSNEFLREYVIKDAVEQGVVKEVVQQTRPSTPPPIETEQLEPPEDEVLEEGVWS 137

  Fly   106 TESPIEPKLSYEGDDIKDHILCEPVIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVK 170
            ||.|||                             ::.:|            |.|:|.|....|:
  Fly   138 TEDPIE-----------------------------ETPHG------------PAEKERPTVLTVE 161

  Fly   171 PRPRGRPRKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDED 235
            ..|...|                                                          
  Fly   162 MLPAPYP---------------------------------------------------------- 168

  Fly   236 EEDEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKL 300
                       .|.:...|.|.|                                    |...||
  Fly   169 -----------PPASTPPPAPAG------------------------------------AVKGKL 186

  Fly   301 D-CAICAAPLEDFNDLKRHFRVEHDCTGYVKC--CNNRYKKRTLYVDHLHCHKDPQYFSCQSCRK 362
            . ||||.......:.|..|.|..:|...| :|  |:..:........|:..|...:.::||.|::
  Fly   187 HVCAICGNGYPRKSTLDTHMRRHNDERPY-ECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQR 250

  Fly   363 NFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTK 427
            ||.:|.|.|.|. |.|  :.|..:.|..|..:|....:|.||.|.|.| |:|.:|..|:|:|...
  Fly   251 NFADRTSLVKHE-RTH--RNERPYACKTCGKKFTYASVLKMHYKTHTG-EKPHICQLCNKSFARI 311

  Fly   428 FELSAHVK-RMHAAD 441
            ..|.||:: :.|..|
  Fly   312 HNLVAHLQTQQHIND 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 23/79 (29%)
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 10/20 (50%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..438 CDD:275368 7/21 (33%)
C2H2 Zn finger 447..465 CDD:275368
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 24/83 (29%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
DUF45 <204..281 CDD:302795 22/80 (28%)
COG5048 210..>345 CDD:227381 38/122 (31%)
C2H2 Zn finger 217..237 CDD:275368 3/19 (16%)
C2H2 Zn finger 245..265 CDD:275368 10/20 (50%)
zf-H2C2_2 257..282 CDD:290200 9/27 (33%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 12/24 (50%)
C2H2 Zn finger 301..320 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.