DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG14711

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:481 Identity:105/481 - (21%)
Similarity:174/481 - (36%) Gaps:131/481 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCL-ED--AEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLA 62
            |:||:|| ||  :|...|:|.......:...|::.|:  ..:.||..:|  :.:.||..|..:|.
  Fly     5 MLCRICLTEDINSEAMAPLFDDNDAQCRELVRKIEEV--GSIKLVPLQN--IPSMLCYSCVERLT 65

  Fly    63 EIEQFCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILC 127
            ...:|..:..|.:|:...:: :|.|:...|  |:..|.:|..|.|                :|. 
  Fly    66 SAHKFRELCQESERTFATNV-VKAEMKSEP--TDEVPHVVADNIE----------------YIY- 110

  Fly   128 EPVIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRK 192
                       |..:|:.|..|.|...|   :..|||..|.|....:.....|.:          
  Fly   111 -----------ESANDFIDGVEDDIGME---NIMEEPLEDGVGETSQAYETSTVV---------- 151

  Fly   193 YEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPR 257
                                                      |:.||:|:....:.|:|.||..|
  Fly   152 ------------------------------------------DDLDEDDLLVPNSTDSDYQPIER 174

  Fly   258 -----------GKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLED 311
                       .||||.:.:...:......:.|.|..::|.|...:..:.|:.  |.||......
  Fly   175 CRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIM--CEICGNIYSK 237

  Fly   312 FNDLKRHFRVEHDCTGYVKC--CNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHM 374
            ...|..|.| .|......||  |:..:...:....|:..|...:.|.|:.|.::|.:|:|.:.|.
  Fly   238 RAALNIHMR-RHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHE 301

  Fly   375 LRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHA 439
             |.|:.::...  |:.|...|:...:|..|:..|.| |:|.:|..|:|||..|.:|..|:..|  
  Fly   302 -RTHTNERPFT--CSTCGKAFSYSNVLKNHMLTHTG-EKPFLCRVCNKTFSRKHQLDQHLGTM-- 360

  Fly   440 ADFTPIICDICGTHFRSKANFLIHKK 465
                        ||.::    :||.|
  Fly   361 ------------THQQT----VIHHK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 21/78 (27%)
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 7/20 (35%)
C2H2 Zn finger 388..408 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 447..465 CDD:275368 4/17 (24%)
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 21/78 (27%)
C2H2 Zn finger 228..248 CDD:275368 6/20 (30%)
zf-H2C2_2 240..264 CDD:290200 7/24 (29%)
COG5048 249..>362 CDD:227381 32/130 (25%)
C2H2 Zn finger 256..276 CDD:275368 3/19 (16%)
zf-H2C2_2 268..292 CDD:290200 5/23 (22%)
C2H2 Zn finger 284..304 CDD:275368 7/20 (35%)
zf-H2C2_2 299..321 CDD:290200 6/24 (25%)
C2H2 Zn finger 312..332 CDD:275368 5/19 (26%)
zf-H2C2_2 325..349 CDD:290200 11/24 (46%)
C2H2 Zn finger 340..362 CDD:275368 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.