DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG31388

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:625 Identity:133/625 - (21%)
Similarity:200/625 - (32%) Gaps:205/625 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ICRLCLEDAEHGVP--IFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEI 64
            |||.|...|:..|.  :|       .|:...:...||....|.|.|:..:...:|..|...|...
  Fly     4 ICRTCSRMADPAVAKNLF-------DPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIA 61

  Fly    65 EQFCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHIL-CE 128
            ..|..:..|.|..|  .|||:       ::.:.|.|.     ||..|..|    ||..|.:. ..
  Fly    62 IDFRRVCIEAQELL--ELQLR-------QVEKEEEAF-----ESLAEQWL----DDCPDELSNLS 108

  Fly   129 PVIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKY 193
            ||:           ...|..:..|:||.|....:|                              
  Fly   109 PVL-----------QLNDRMDFIFDPEPQDKNTDE------------------------------ 132

  Fly   194 EKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPRG 258
                   .|.|...:..|.....:.:....:..|...|.....| ..|:|  |:|:::.:.:   
  Fly   133 -------LASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNE-HFDMG--LSPESEPESE--- 184

  Fly   259 KRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEH 323
                        |.||.|||.                   ...|:.|....|:.::||.|....|
  Fly   185 ------------AIDNRDTSS-------------------SHTCSKCGLEFENVDELKLHKYHLH 218

  Fly   324 DC---TGYVKC--CNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMH-MLRFHSQQ- 381
            |.   |.:| |  |:..::.......|.:....|...||..|:..|.|      | :|..|.|: 
  Fly   219 DIPPDTKFV-CDHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQFHN------HILLETHKQRC 276

  Fly   382 ---QELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFT 443
               ....|.|.||.......|.|..||..|.||.|.: ||.||.:|.|..||.:| ::.|..: .
  Fly   277 LRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHK-CDQCSASFYTAAELCSH-QKTHTTE-R 338

  Fly   444 PIICDI-CGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTKY 507
            |.||.. ||..||..:...:|:: :|.|.                    .|.:           |
  Fly   339 PYICRYNCGKTFRFCSARSMHER-VHMDA--------------------SKRI-----------Y 371

  Fly   508 RCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTF 572
            :|..|.....:.:...:|.:||:..:.|.|.:|...||    .|:|                  :
  Fly   372 QCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFK----TAKH------------------Y 414

  Fly   573 KSHANMHNHKKKMHPNDWVRKYSQPSSSITSTAAPLAHPN 612
            :||...:.||                 ::.:.|...|.||
  Fly   415 RSHLKSNAHK-----------------TLEARAKAAASPN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 19/77 (25%)
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 6/21 (29%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..438 CDD:275368 9/20 (45%)
C2H2 Zn finger 447..465 CDD:275368 6/18 (33%)
C2H2 Zn finger 478..498 CDD:275368 1/19 (5%)
C2H2 Zn finger 509..529 CDD:275368 3/19 (16%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 3/17 (18%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 20/80 (25%)
C2H2 Zn finger 228..254 CDD:275368 4/25 (16%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 9/20 (45%)
C2H2 Zn finger 342..363 CDD:275368 6/21 (29%)
C2H2 Zn finger 373..393 CDD:275368 3/19 (16%)
C2H2 Zn finger 401..419 CDD:275368 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.