DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG8159

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:191 Identity:52/191 - (27%)
Similarity:74/191 - (38%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 KGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPI-ICDICGTHFRSKANFLIHKKALHP 469
            ||.||..            |||..|             |: .||.||.:...|::|..|   |..
  Fly   177 KGGKGEN------------RTKVTL-------------PVFFCDQCGNNITGKSSFDRH---LRK 213

  Fly   470 DGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKR 534
            ...:...||.||.........|:.|...|   .||.|::|..|:....:.:....|.|.|.:.:.
  Fly   214 HSGIRPFQCELCPARFLSSGELKGHQVMH---TGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRP 275

  Fly   535 HKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRT----------FKSHANMHNHKKKM 585
            ..|:.|.|.|.....|..||..|||..|::|:.|.|:          |:|:.:.||.:|.|
  Fly   276 FICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTHFRSNTHKHNLEKSM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368
C2H2 Zn finger 357..378 CDD:275368
C2H2 Zn finger 388..408 CDD:275368 1/1 (100%)
C2H2 Zn finger 417..438 CDD:275368 4/20 (20%)
C2H2 Zn finger 447..465 CDD:275368 7/17 (41%)
C2H2 Zn finger 478..498 CDD:275368 5/19 (26%)
C2H2 Zn finger 509..529 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..583 CDD:275368 7/27 (26%)
CG8159NP_649823.2 zf-AD 5..78 CDD:214871
C2H2 Zn finger 194..214 CDD:275368 8/22 (36%)
COG5048 <197..322 CDD:227381 35/130 (27%)
zf-H2C2_2 206..231 CDD:290200 7/27 (26%)
C2H2 Zn finger 222..242 CDD:275368 5/19 (26%)
C2H2 Zn finger 250..270 CDD:275368 4/19 (21%)
zf-H2C2_2 265..287 CDD:290200 7/21 (33%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-H2C2_2 291..315 CDD:290200 10/23 (43%)
C2H2 Zn finger 306..328 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.