DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and ouib

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:249 Identity:58/249 - (23%)
Similarity:95/249 - (38%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 EDDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDT----SEVPVKRSSI 287
            :|...||||..|..::..|....:|...|..|:......:.|:..:..|.|    ::..::...|
  Fly    81 DDSSSGDEDTNDNSELESEKCAFSDFGKKKEGELVEETFQVLIEEEPMDKTLNRDAKAQLREDGI 145

  Fly   288 KE----MDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHC 348
            .|    ....|..:.|||..|....|                      |......:..:..|:..
  Fly   146 DEKCVPSQKIIKVSTKLDDQIYICEL----------------------CGTHATSKPTFQRHMRK 188

  Fly   349 HKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTER 413
            |:..:.|.|:.|...||:......|. |.|:.:|...  |..||.|:.......:|.:.|. .:|
  Fly   189 HRGERPFGCKDCDARFLSAGELRAHH-RVHTGEQPFA--CRFCEKRYVSYMGRLIHERTHT-NDR 249

  Fly   414 PEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKAL 467
            |.||:.|.|.|.|.:.|..|:. :|..: ....||||...|:.||:.:.|.:::
  Fly   250 PYVCEECGKKFTTAYVLKNHMV-IHTGE-RNFRCDICDRSFQRKAHLVTHTRSM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 8/17 (47%)
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
ouibNP_649822.2 zf-AD 5..78 CDD:214871
COG5048 <158..300 CDD:227381 42/169 (25%)
C2H2 Zn finger 169..189 CDD:275368 3/41 (7%)
C2H2 Zn finger 197..217 CDD:275368 6/20 (30%)
zf-H2C2_2 209..234 CDD:290200 8/27 (30%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
zf-H2C2_2 241..262 CDD:290200 9/21 (43%)
C2H2 Zn finger 253..273 CDD:275368 7/20 (35%)
zf-H2C2_2 266..288 CDD:290200 7/23 (30%)
C2H2 Zn finger 281..299 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.