DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and nom

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:534 Identity:106/534 - (19%)
Similarity:171/534 - (32%) Gaps:194/534 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LCNRCWRQLAEIEQFCSMVAE----KQRSLHRSLQLKTE--LPELPELTEPEPALVVWNTESPIE 111
            :|..|.|     .:.|....|    .::.:.|.:||.|.  |.::|.    .|.:|.:..::.::
  Fly     5 VCRVCGR-----SRLCPKAVELFKPGRQDILRRIQLITGILLQQIPN----APDMVCFCCQTDLQ 60

  Fly   112 PKLSYEGDDIKDHILCEPVI--DALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPR 174
            ..:.:....|.......|::  |.:.|.:||      ..||: :|.::....:         |.|
  Fly    61 SAMIFRRQCILQQKKWVPLLQSDKVGASEEK------KVEPN-DPSTKKKTTK---------RRR 109

  Fly   175 GRPRKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDE 239
            ||||.                     ..:|.::.:         ...|.|.|.:...|||.::..
  Fly   110 GRPRM---------------------PLEIVDIVV---------TNESKASAGESVGGDEFDQPV 144

  Fly   240 EDVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMD----DYIAANVKL 300
            | :..|  |||.:                         |:|.::...:.:.|    |:...||::
  Fly   145 E-ISNE--PDATD-------------------------SDVNLEEIDLPDEDGLESDHDLPNVQI 181

  Fly   301 DCAICAAPLEDFNDLKRHFRVEHDC--TGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKN 363
                                  |.|  .|.:|  ||    ::..|.|...|...:.:.|:.|.|.
  Fly   182 ----------------------HKCDTCGIIK--NN----KSSLVRHQFEHNGIRPYPCKECPKT 218

  Fly   364 FLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKF 428
            ||..:....|.|..|:.:....  |..|:.|:........|.:.|. .|||.|||.|.|.|....
  Fly   219 FLVASELKAHNLTHHTLEPPFA--CRYCDRRYFSVVGRKKHERVHT-NERPFVCDQCGKAFTRTC 280

  Fly   429 ELSAH-----VKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDE 488
            .|.||     |.|.::       ||:|...|                                  
  Fly   281 ILKAHMAVHQVVRKYS-------CDVCDRSF---------------------------------- 304

  Fly   489 RSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEH 553
             ||:||||.|           .:.|..|.:..|::|...|        .|:...|.....:....
  Fly   305 -SLKKHLATH-----------FISNTHKRNAEAVTSSSEY--------MSMLSFESDETWSQGTP 349

  Fly   554 MATHTGIDLYQCQF 567
            :.|....||.|.||
  Fly   350 LTTSIDEDLVQSQF 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 5/28 (18%)
C2H2 Zn finger 332..349 CDD:275368 4/16 (25%)
C2H2 Zn finger 357..378 CDD:275368 7/20 (35%)
C2H2 Zn finger 388..408 CDD:275368 4/19 (21%)
C2H2 Zn finger 417..438 CDD:275368 10/25 (40%)
C2H2 Zn finger 447..465 CDD:275368 4/17 (24%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..529 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 2/19 (11%)
C2H2 Zn finger 565..583 CDD:275368 2/3 (67%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 14/79 (18%)
C2H2 Zn finger 184..204 CDD:275368 7/25 (28%)
C2H2 Zn finger 212..261 CDD:275368 12/50 (24%)
zf-H2C2_2 255..278 CDD:290200 11/23 (48%)
C2H2 Zn finger 269..289 CDD:275368 8/19 (42%)
zf-H2C2_2 282..305 CDD:290200 9/64 (14%)
C2H2 Zn finger 297..313 CDD:275368 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.