DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and Zif

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:458 Identity:93/458 - (20%)
Similarity:157/458 - (34%) Gaps:147/458 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 EPESQPDE--------------EEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKYEKRKQQNKAK 203
            |.|..|:|              :.|..||.:     .:..|..|...:| .:.|..:::.:.:..
  Fly    29 EGEESPNEMLIQLLGVSYSNLNDREHIPDGI-----CKSCKVELNMAYQ-FREKALRKQMEIEEY 87

  Fly   204 ITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKL 268
            ..||.|         |..|......::||.:.:.|||....|.|...:|:.:.  ::|..:..::
  Fly    88 CRELGL---------LDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQE--EKGHEEYLEV 141

  Fly   269 VTADDND---DTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVK 330
            .|:|..:   ||.|.                            |||      ::.:|.:      
  Fly   142 DTSDQQECIGDTIEY----------------------------LED------NYTIEMN------ 166

  Fly   331 CCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQEL-VHQCAICEAR 394
                                                 :.|...:|....|.:|. ..|.|:.||.
  Fly   167 -------------------------------------SDQTEIVLESEKQYEETPSQQLALQEAA 194

  Fly   395 FAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTP---IICDICGTHFRS 456
            .|.       ||..:|..|                  ..:..:..:|.|.   .|||:||..:..
  Fly   195 KAS-------LKARRGRVR------------------RGLNSLTTSDGTEKGGYICDVCGNFYEK 234

  Fly   457 KANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAA 521
            :...:.|::  ..|| :.:..|.||....:....||||:..|   .|...|:|..|:.:....:.
  Fly   235 RGRMMEHRR--RHDG-ICQYACELCDAKFQVREQLRKHMYSH---TGSKPYKCSFCSRQFFYESV 293

  Fly   522 LSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKK-KM 585
            |.||...|...|.:.|.:|||.|....:|.:|...|:.|.||:|.:|.:.|:...:|..|:: |:
  Fly   294 LKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEETKL 358

  Fly   586 HPN 588
            |.|
  Fly   359 HQN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 0/16 (0%)
C2H2 Zn finger 357..378 CDD:275368 2/20 (10%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 0/20 (0%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..529 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..583 CDD:275368 5/17 (29%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 11/63 (17%)
C2H2 Zn finger 225..245 CDD:275368 5/21 (24%)
COG5048 <250..369 CDD:227381 36/115 (31%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..288 CDD:290200 9/24 (38%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
zf-H2C2_2 294..318 CDD:290200 10/23 (43%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
C2H2 Zn finger 337..353 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.