DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG14667

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:230 Identity:60/230 - (26%)
Similarity:95/230 - (41%) Gaps:36/230 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 TADDNDDTSEVPVKRSSIKEMDDYIAANV--KLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKC- 331
            |.:::.|..|:        |:||..:|.|  ..:.|..||..||..:.:.. |.....:.:..| 
  Fly   125 TKEEHQDLEEI--------ELDDDPSAAVIAAAEAAAEAAQQEDLQEQEME-RAAKRRSNFFICD 180

  Fly   332 -CNNRYKKRTLYVDHLHCHKD----PQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVH---QC 388
             |...:....||.:||:.|::    .|:|.|..|.:.| |:.:    :|:.|..|..|::   ||
  Fly   181 ECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTF-NKKA----LLKQHRTQVHLINRRFQC 240

  Fly   389 AICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTH 453
            .||...||.......|.|.|| .|||..|..|...|.:..||..|.. .|:.......|:.|...
  Fly   241 TICHEAFASLGAKLRHDKAHK-NERPYPCLECGMIFSSVSELQNHFS-THSKQIRKFRCEPCNMD 303

  Fly   454 FRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDE 488
            |.::...:.|.|.. |...:|        ::::||
  Fly   304 FITRRGLVAHTKTA-PHKRLA--------KYMQDE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 5/16 (31%)
C2H2 Zn finger 357..378 CDD:275368 5/20 (25%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 447..465 CDD:275368 4/17 (24%)
C2H2 Zn finger 478..498 CDD:275368 2/11 (18%)
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 7/25 (28%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-C2H2_8 243..313 CDD:292531 20/71 (28%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
C2H2 Zn finger 297..316 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.