DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and Kr

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:387 Identity:82/387 - (21%)
Similarity:136/387 - (35%) Gaps:90/387 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 TPDADEQPKPRGKRGRP-------KTKKLVTADDNDDTSEVPV----KRSSIKEMDDYIAANVKL 300
            :|::..|.....|:.|.       :|:..::.:|...||..|:    ..||.....|....|   
  Fly   145 SPNSTPQHHEPAKKARKLSVKKEFQTEISMSVNDMYHTSGGPISPPSSGSSPNSTHDGAGGN--- 206

  Fly   301 DCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFL 365
              |.|....:|         ...|.:...|.|:..:..:.:..:|...|...:.|.|..|.|.|.
  Fly   207 --AGCVGVSKD---------PSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFT 260

  Fly   366 NRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFEL 430
            ..:....|| |.|:.::.  :.|:.|:.:|.:...|..||:.|.| |||..|:.|...|....:|
  Fly   261 RDHHLKTHM-RLHTGEKP--YHCSHCDRQFVQVANLRRHLRVHTG-ERPYTCEICDGKFSDSNQL 321

  Fly   431 SAHVKRMHAADFTPIICDICGTHFRSKANFLIHK--------KALHP----DGPVA------EVQ 477
            .:|: .:|..: .|..|:.|...||.:.:.:.||        .||.|    |.|||      |..
  Fly   322 KSHM-LVHNGE-KPFECERCHMKFRRRHHLMNHKCGIQSPPTPALSPAMSGDYPVAISAIAIEAS 384

  Fly   478 ----CTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCS 538
                ..:|..:.....|:....|..:| ||.       .:..:...:::..|.   .:..|.|..
  Fly   385 TNRFAAMCATYGGSNESVDMEKATPED-DGP-------LDLSEDGASSVDGHC---SNIARRKAQ 438

  Fly   539 LCDKEFKL-------------------------PRALAEHMATHTGIDLYQCQFCTRTFKSH 575
            ...:.|:|                         ||::..|..| ..||||.......::..|
  Fly   439 DIRRVFRLPPPQIPHVPSDMPEQTEPEDLSMHSPRSIGSHEQT-DDIDLYDLDDAPASYMGH 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 7/20 (35%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 447..465 CDD:275368 6/25 (24%)
C2H2 Zn finger 478..498 CDD:275368 3/19 (16%)
C2H2 Zn finger 509..529 CDD:275368 1/19 (5%)
C2H2 Zn finger 537..557 CDD:275368 5/44 (11%)
C2H2 Zn finger 565..583 CDD:275368 1/11 (9%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 3/19 (16%)
zf-H2C2_2 237..261 CDD:290200 7/23 (30%)
C2H2 Zn finger 252..272 CDD:275368 7/20 (35%)
zf-H2C2_2 264..289 CDD:290200 7/27 (26%)
C2H2 Zn finger 280..300 CDD:275368 6/19 (32%)
zf-H2C2_2 292..316 CDD:290200 10/24 (42%)
C2H2 Zn finger 308..328 CDD:275368 5/20 (25%)
zf-H2C2_2 321..345 CDD:290200 7/25 (28%)
C2H2 Zn finger 336..352 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.