DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and pita

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster


Alignment Length:657 Identity:133/657 - (20%)
Similarity:216/657 - (32%) Gaps:183/657 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ICRLCLEDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCL-CNRCWRQLAEIE 65
            :||.||.: :....||.:.|.:...|:..|..:....:.:...:......|| |...:......:
  Fly    17 VCRFCLTE-QKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRFK 80

  Fly    66 QFCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIE-PKLSYEGDDIKDHILCEP 129
            |.|.             :.:|.|.:.|         :..|..||:| |:........|..::.  
  Fly    81 QMCK-------------RAETLLRQYP---------LTGNWPSPLEKPRAPMTMVASKKLLVV-- 121

  Fly   130 VIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKYE 194
                                        |.:..||...|.|      ...|..:.:.|:|   .|
  Fly   122 ----------------------------PAKTAEPSETPKK------LLNTMAKSSSQVI---IE 149

  Fly   195 KRKQQNKAKITELSLRES-----RARQRELKRSSAGAEDDQDGDEDEEDE--EDVGGELT---PD 249
            ..:....|.:|..::..|     |:...|||     .:::|:...|:...  ||:..||.   ||
  Fly   150 DVQVLESAMVTPRTVAGSSPVPRRSHAYELK-----VDNNQELSMDDVQSMLEDMASELEKEFPD 209

  Fly   250 ADEQPKP---------------RG-------KRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDD 292
            ..::..|               :|       :...||.|:       ||:..|.:    :.|:  
  Fly   210 IPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKR-------DDSGNVAI----VTEV-- 261

  Fly   293 YIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKC--CNNRYKKRTLYVDHLHCHKDPQYF 355
                   ||..:   ||:|.:|..::  .|...|....|  |...:..:.|...|...|...:.|
  Fly   262 -------LDSDL---PLDDQDDPTKN--AEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSF 314

  Fly   356 SCQSCRKNFLNRNSQVMHMLRFHSQQQELVH------QCAICEARFAKKFLLTMHLKGHKGTERP 414
            .|..|.|:|.::.....|         ..||      :||||...|.:|.||..|.:.|  |:.|
  Fly   315 QCLLCEKSFFSKYDLAKH---------NFVHTGERPFKCAICSKAFTRKALLHRHERTH--TDVP 368

  Fly   415 E-VCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQC 478
            : :|..|.|.|.::.|:..|.:|....  .|..|.:|...|..|.....|:.....:.|   ..|
  Fly   369 KFICVYCEKPFLSRQEMEKHAERHQKK--RPFQCGVCTKSFAFKQGLERHETVHSTNLP---FPC 428

  Fly   479 TLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYH-------------- 529
            ..|.|.......|.:||..|   .|...|.|..|:........||.|:|.|              
  Fly   429 QHCERSFSTASKLARHLVAH---AGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECK 490

  Fly   530 ---------------HSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMH 579
                           |:....||.:|.|:.:...::..||..|...:.:.|:||...|.:...:.
  Fly   491 VSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCDHIFLTQKCLQ 555

  Fly   580 NHKKKMH 586
            .|.:..|
  Fly   556 RHIEDDH 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 14/76 (18%)
C2H2 Zn finger 332..349 CDD:275368 3/16 (19%)
C2H2 Zn finger 357..378 CDD:275368 5/20 (25%)
C2H2 Zn finger 388..408 CDD:275368 9/19 (47%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..583 CDD:275368 5/17 (29%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 16/88 (18%)
COG5048 <281..506 CDD:227381 56/243 (23%)
C2H2 Zn finger 288..308 CDD:275368 4/19 (21%)
C2H2 Zn finger 316..336 CDD:275368 5/28 (18%)
zf-H2C2_2 328..353 CDD:290200 8/33 (24%)
C2H2 Zn finger 344..364 CDD:275368 9/19 (47%)
C2H2 Zn finger 372..388 CDD:275370 5/15 (33%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 428..448 CDD:275368 6/19 (32%)
C2H2 Zn finger 456..476 CDD:275368 6/19 (32%)
C2H2 Zn finger 486..506 CDD:275368 0/19 (0%)
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.