DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and Clamp

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster


Alignment Length:451 Identity:93/451 - (20%)
Similarity:153/451 - (33%) Gaps:149/451 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 RKQQNKAKITEL------SLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGEL-------- 246
            ::||:::|.::.      .|::|:.:..:..|..:..:.:|...:.::......|::        
  Fly   209 QQQQHESKASKCINCGSSMLQQSKRKGPKQVRCESCMQAEQTAQQQQQLFVAQDGQMAHPVQIIS 273

  Fly   247 -TPDADEQPKPRGKRGRPKTKKLVTADDNDDT---------SEVPVKRSSIKEMDDYIAANVKLD 301
             ||.|..|           .:::|.|.....|         ...|||:.:.::|         ..
  Fly   274 TTPQAQAQ-----------LQQIVAAQTGGTTPKREASSGSGHHPVKKRNSQQM---------TK 318

  Fly   302 CAICAAPLEDFND-----LKRHFRVEHD-CTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSC 360
            |..|       |.     :.:|....|. ..|.||      :..|:..:.|.|....:.|||..|
  Fly   319 CQKC-------NGSGVVLVGQHSHASHSGVGGSVK------QSVTVKTECLSCRNPSKPFSCNIC 370

  Fly   361 RKNFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFR 425
            ...| :|.|.:....:.||.::.  ::|:||...|||...|..|.:.|.| |:|..|.||...|.
  Fly   371 GGLF-SRYSSLWSHKKLHSGEKN--YKCSICGLAFAKAVYLKNHARIHTG-EKPYKCQTCGMQFS 431

  Fly   426 TKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERS 490
            ....|..| :|.|:.: .|.:|.:|.                                       
  Fly   432 QSPHLKNH-ERTHSGE-RPYVCGVCD--------------------------------------- 455

  Fly   491 LRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMA 555
              |..|||                     |.|.:|.|.|...|.:||.:|...|.....|..|..
  Fly   456 --KGFARH---------------------ATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAK 497

  Fly   556 THTGIDLYQCQFCTRTF------KSHANMHNHKKKMHPNDWVRKYSQPSSSITSTAAPLAH 610
            .|:|...|:|:.|:..|      |.|..:|            :||.|.:...||:...:.|
  Fly   498 VHSGEKPYKCEICSAAFADRFALKRHRGIH------------QKYGQTAPRQTSSDGMIVH 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 5/20 (25%)
C2H2 Zn finger 388..408 CDD:275368 8/19 (42%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 2/17 (12%)
C2H2 Zn finger 478..498 CDD:275368 2/19 (11%)
C2H2 Zn finger 509..529 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..583 CDD:275368 6/23 (26%)
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 48/206 (23%)
C2H2 Zn finger 367..387 CDD:275368 5/20 (25%)
zf-H2C2_2 379..403 CDD:290200 5/25 (20%)
C2H2 Zn finger 395..415 CDD:275368 8/19 (42%)
zf-H2C2_2 407..432 CDD:290200 10/25 (40%)
C2H2 Zn finger 423..443 CDD:275368 7/20 (35%)
zf-H2C2_2 435..460 CDD:290200 8/67 (12%)
C2H2 Zn finger 451..471 CDD:275368 10/81 (12%)
zf-H2C2_2 464..488 CDD:290200 9/23 (39%)
COG5048 475..>529 CDD:227381 16/65 (25%)
C2H2 Zn finger 479..499 CDD:275368 5/19 (26%)
zf-H2C2_2 491..515 CDD:290200 7/23 (30%)
C2H2 Zn finger 507..527 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.