DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG17568

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:603 Identity:140/603 - (23%)
Similarity:224/603 - (37%) Gaps:151/603 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CRLCLEDAEHG-VPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIEQ 66
            ||||.:|..|| |.:...|...|. ....|...|.::..:.:...|.:|:.||..|:..::|:..
  Fly    11 CRLCAKDDAHGNVKVQMNENSQGN-WDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISELID 74

  Fly    67 FCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEG--DDIKDHILCEP 129
            |...|.:.|           ::.|:...||.:     .:.|..:.......|  ||...||: :|
  Fly    75 FAEHVTKVQ-----------DIFEVLRRTETD-----GDQEMDVAALRQQFGLCDDDWTHII-KP 122

  Fly   130 VIDALSAGDEKDSDYGDTFE--PDF---EPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQII 189
             |.||..  |.|:.|....|  .||   |..||..|..:            |...|.|.||.:.:
  Fly   123 -IPALEM--ESDNVYQKPAELLKDFPLAETSSQEMEISK------------RTTTTHLIQTKKNV 172

  Fly   190 KRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQP 254
            :.:..|::..:...|    |.|....|.                    |.|||..||..:...||
  Fly   173 EMEIPKQEFIDLGPI----LLEKNTSQL--------------------DMEDVLDELPQEELSQP 213

  Fly   255 K------PRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAP--LED 311
            :      |.......|::.|.:.:.:||.  :||.    .::.|.:        |:...|  ||.
  Fly   214 RLDSTTSPASMENDVKSEMLDSCEGDDDF--LPVD----GQLMDLV--------AVATTPNTLES 264

  Fly   312 FNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLR 376
            ..:.|.. |...||    :.|...|:.|..|..||.          :.||:  :.|..:|     
  Fly   265 TAEEKAK-RGRMDC----EKCGKVYRNRASYEKHLE----------RECRR--IERRVKV----- 307

  Fly   377 FHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAAD 441
                 .:....|.||....:....|.:|.:|.....:|.:||:|.|..:|...|:.| |.:| .:
  Fly   308 -----DKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEH-KLVH-TE 365

  Fly   442 FTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTK 506
            ..|..|.:|...|:::|....|.: :|.:   ....|.:||:.|:..|:...|...|.:.     
  Fly   366 SRPFECTVCKAGFKNRARLKAHYQ-IHAE---PSFVCNICGKKLQTRRTWNMHKVVHTEE----- 421

  Fly   507 YRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRT 571
                                      :|.||.:|...||..:.|..|:.:|||:..|.|.:|.::
  Fly   422 --------------------------RRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKS 460

  Fly   572 FKSHANMHNHKKKMHPND 589
            |..:||..:||.|.||.:
  Fly   461 FACNANCRSHKLKKHPQE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 21/75 (28%)
C2H2 Zn finger 332..349 CDD:275368 6/16 (38%)
C2H2 Zn finger 357..378 CDD:275368 4/20 (20%)
C2H2 Zn finger 388..408 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..529 CDD:275368 0/19 (0%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 6/17 (35%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 21/87 (24%)
COG5048 <313..471 CDD:227381 47/194 (24%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
C2H2 Zn finger 343..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 371..391 CDD:275368 5/20 (25%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-H2C2_2 439..463 CDD:290200 9/23 (39%)
C2H2 Zn finger 454..475 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.