DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG17328

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:292 Identity:76/292 - (26%)
Similarity:108/292 - (36%) Gaps:48/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 SCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKT 423
            |.|::...|.....|..|......::.|.|..|...|.....||.|::.|.| |:|..|..|.:.
  Fly   120 SKRRSRYQRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTG-EKPYQCSFCIQR 183

  Fly   424 FRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDE 488
            |..|:.|..| :|.|..| .|..|:||...|.:..||..|:| :|..  |.:..|:||.:.....
  Fly   184 FAQKYNLKVH-ERTHTGD-KPFQCEICSKQFSALGNFQAHQK-IHLG--VRDQVCSLCQKGFYTA 243

  Fly   489 RSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSH-MRYH--HSAKRH--------------- 535
            ..|.||:..|   .|...:.|.:|....|.|..:.:| ::.|  .|:..|               
  Fly   244 GDLSKHMITH---TGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAIDTDP 305

  Fly   536 -----------KCSLCDKEFKLPRALAEHMATH-TGIDLYQCQFCTRTFKSHANMHNHKKKMHPN 588
                       ||..|||.|....:|:.|..|| ...:|...........||   |.|...:|  
  Fly   306 VGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTHAANNNLLNLPLPPAPPMSH---HYHHDALH-- 365

  Fly   589 DWVRKYSQPSSSITSTAAPLAHPNHPNQPAPP 620
                ....|:.:.....|.:||...|..|.||
  Fly   366 ----HLGPPNPATQMGMAAMAHMLAPPPPPPP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368
C2H2 Zn finger 357..378 CDD:275368 5/18 (28%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 7/17 (41%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..529 CDD:275368 5/20 (25%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..583 CDD:275368 4/17 (24%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 24/67 (36%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 7/20 (35%)
zf-H2C2_2 189..213 CDD:404364 9/25 (36%)
C2H2 Zn finger 205..225 CDD:275368 8/20 (40%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 7/27 (26%)
C2H2 Zn finger 261..282 CDD:275368 5/20 (25%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.