DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and Kr-h1

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:378 Identity:88/378 - (23%)
Similarity:132/378 - (34%) Gaps:91/378 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 PQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQEL-------------------------------- 384
            || |.|..|...|.::::...| .:.||:.|:|                                
  Fly   192 PQ-FKCDQCGMTFGSKSAHTSH-TKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPK 254

  Fly   385 ---------------VHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHV 434
                           .:||.:|:..||....|..|.:.|.| |||..|:.|.|.|..|..|..| 
  Fly   255 SPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTG-ERPFECEFCHKLFSVKENLQVH- 317

  Fly   435 KRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHD 499
            :|:|..: .|..||:||..|........|.:....:.|   .:|::|.:.......|..|:..| 
  Fly   318 RRIHTKE-RPYKCDVCGRAFEHSGKLHRHMRIHTGERP---HKCSVCEKTFIQSGQLVIHMRTH- 377

  Fly   500 DRDGDTKYRC--------LLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMAT 556
              .|:..|:|        ..|:.:      |..|.|.|...|.:.|.:|.::|.....|..|...
  Fly   378 --TGEKPYKCPEPGCGKGFTCSKQ------LKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQ 434

  Fly   557 HTGIDLYQCQFCTRTFKSHANMHNHKKKMH----PNDWVRKYSQPSSSITSTAAPLAHP------ 611
            |.|...|:|..|..|||:...|..|.|. |    |:|.....:..:::.||..:....|      
  Fly   435 HYGSKCYKCTICDETFKNKKEMEAHIKG-HANEVPDDEAEAAAASAAASTSAGSSAGSPSLQGVS 498

  Fly   612 ------NHPNQPAPPAAAPTNLAGHMLPPLGGIAKSLIEIPDTEGFDFGSNSS 658
                  ||....:|||......|..  |.:.....:.:.||.:......|.||
  Fly   499 SNSESSNHSPPSSPPATKKPRQARQ--PRVSKTVAATLSIPTSSPLSPSSLSS 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368
C2H2 Zn finger 357..378 CDD:275368 4/20 (20%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 447..465 CDD:275368 6/17 (35%)
C2H2 Zn finger 478..498 CDD:275368 4/19 (21%)
C2H2 Zn finger 509..529 CDD:275368 5/27 (19%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..583 CDD:275368 7/17 (41%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/20 (20%)
COG5048 <270..420 CDD:227381 45/164 (27%)
zf-C2H2 271..293 CDD:278523 7/21 (33%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..309 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 313..338 CDD:290200 10/26 (38%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 4/24 (17%)
C2H2 Zn finger 357..377 CDD:275368 4/19 (21%)
zf-H2C2_2 370..396 CDD:290200 6/28 (21%)
C2H2 Zn finger 385..407 CDD:275368 5/27 (19%)
zf-H2C2_2 400..424 CDD:290200 8/23 (35%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-C2H2 441..463 CDD:278523 9/22 (41%)
C2H2 Zn finger 443..463 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.