DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG17612

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:630 Identity:131/630 - (20%)
Similarity:217/630 - (34%) Gaps:164/630 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LHRSLQLKTE--LPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILCEPVIDALSAGD-- 138
            :|..:.:..|  |||.|  ..||..|||...::.|:.|:..|     :||..|.:|.|.:..|  
  Fly    53 VHLEMSINGEDGLPEHP--LYPEVQLVVKEEDALIKKKVIEE-----NHIHNEEIIGASNIVDVE 110

  Fly   139 -----EKDSD---YGDTFEPDFEPESQP---------DEEEEPEPDPVKPRP-RGRPRKTALQQT 185
                 ..::|   ..|:|..:...|..|         |...|.|...:|... .|..    ||..
  Fly   111 VHENHRANNDVILIQDSFAEEVILEDHPANNDVIIIQDSVAEEELPVIKEEAIEGED----LQGE 171

  Fly   186 HQIIKRKYEK----------RKQQNKAKITE--------LSLRESRARQRELKRSSAGAE----- 227
            :.||....|:          .:..|...|.:        ::...|:.....:::..:.:|     
  Fly   172 YFIITECLEEPAIGSCRVCLEQSDNLTNIFDDAHQYGIPIATILSQYTGMPVEKGDSFSEYICVT 236

  Fly   228 ---------DDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVK 283
                     ||.:..|:           |.....|||                ::..|...:|||
  Fly   237 CLDVVKNAFDDLESKEN-----------TIQMYRQPK----------------EEIIDIDSIPVK 274

  Fly   284 RSSIKEMDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDC----TGYVKC--CNNRYKKRTLY 342
            .   |.:|..:.......|..|.........|:.|.|..::.    ...:||  |.:.|.||...
  Fly   275 N---KPVDYEVTGKPPHRCPQCPKIFLLAAKLQAHIRTHNETRTTEPPRLKCPMCPSIYMKRGCL 336

  Fly   343 VDHLHCHK---------DPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQEL----VHQCAICEAR 394
            ..|:..|:         :|.| .|..|.|.||..:...:|:.......|.|    .|:||.|...
  Fly   337 EAHMWIHRASDERESELEPPY-RCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADV 400

  Fly   395 FAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKAN 459
            |:....|..|:|.|.| ||...|..|..:|:.:..|     :.|....|...|..|...|.|: |
  Fly   401 FSDVSSLKDHVKIHAG-ERTFKCPLCLMSFQEESNL-----KSHDCAHTRFKCHKCSKFFESQ-N 458

  Fly   460 FL-IHKKALH-PDGPVAEVQCTLCGRWLRDERSLRKHLARH------DDRDGDTKYRCLLCNAEK 516
            :| .|.|..| ..||   .:|..|.:..:....|::|::..      ..:.....:.|..|    
  Fly   459 YLDFHFKKSHTTKGP---FKCIKCQQTFQKRNGLKEHISSQVCVQFLRSKSPGQIFPCPKC---- 516

  Fly   517 SSRAALSSHMRYHHSA--------KRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFK 573
            ..:.::..:.:.||:.        :||.|:.|.|.::..:.|.:|:.:|.     :|..|:.:|.
  Fly   517 PKKFSIEDNYQMHHATHKKVKTVIERHNCTQCKKSYQNKKLLTKHILSHN-----RCVHCSMSFT 576

  Fly   574 SHANMHNH-----------KKKMHPNDWVRKYSQPSSSITSTAAP 607
            |...:..|           :.:.:||   ..|::...|..|...|
  Fly   577 SKYLLEQHTCSQSYQLNGSRGRKNPN---LNYNECEESNESDLEP 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 131/630 (21%)
C2H2 Zn finger 332..349 CDD:275368 5/16 (31%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..438 CDD:275368 4/20 (20%)
C2H2 Zn finger 447..465 CDD:275368 7/18 (39%)
C2H2 Zn finger 478..498 CDD:275368 4/19 (21%)
C2H2 Zn finger 509..529 CDD:275368 2/19 (11%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..583 CDD:275368 5/28 (18%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 4/58 (7%)
C2H2 Zn finger 290..310 CDD:275368 5/19 (26%)
C2H2 Zn finger 323..343 CDD:275370 6/19 (32%)
zf-C2H2_8 356..438 CDD:292531 25/88 (28%)
C2H2 Zn finger 359..379 CDD:275368 6/19 (32%)
C2H2 Zn finger 394..414 CDD:275368 7/19 (37%)
C2H2 Zn finger 422..438 CDD:275368 4/20 (20%)
C2H2 Zn finger 447..463 CDD:275368 6/16 (38%)
C2H2 Zn finger 476..505 CDD:275368 4/28 (14%)
C2H2 Zn finger 513..533 CDD:275368 4/23 (17%)
C2H2 Zn finger 545..565 CDD:275368 5/19 (26%)
C2H2 Zn finger 568..584 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.