DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG2889

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster


Alignment Length:665 Identity:179/665 - (26%)
Similarity:285/665 - (42%) Gaps:133/665 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLEDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIE 65
            |||||||.....|..:|..|.. ...|..:|.::|.:.|.|.:..:|.:||.:|..|...|.:..
  Fly     1 MICRLCLRCLSPGSAVFLFETD-DTLAETRLVKMIAKFLQLEILPDDGISTSVCTECCEHLEDFN 64

  Fly    66 QFCSMVAEKQRSLHR----------------SLQLKTELPELPELTEPEPALVVWN-TESPIE-P 112
            .|..:|.:||.||.:                .:.:...:.|||        |...: .|.|:: .
  Fly    65 GFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVNIDELP--------LAAGDMDEKPLDLH 121

  Fly   113 KLSYEGDDIKDHI----LCEPVIDALSAGDEKDSDYGDTFEP-----DFEP---ESQPDEEEEPE 165
            .||..|..:..::    :.||:.:.|...:|:|.      :|     |.||   |.||:.|.:..
  Fly   122 NLSLLGSVLDVNVDSVEVREPIKEQLPCEEEEDE------KPCLQASDSEPEVTEGQPESESDSS 180

  Fly   166 PDP--VKPRPRGRPRKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQREL--------K 220
            .|.  |:.:.:.:|            |||...|..:::..|         :.|:||        |
  Fly   181 DDEPLVRLKSKMKP------------KRKTSARSSKDQGPI---------SLQQELADLLDDGGK 224

  Fly   221 RSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRS 285
            |....|.|.:...|.:|.|        ..|..:.||:|                  .|...:.:|
  Fly   225 RRRRKAPDQRTTTESQESE--------LQAVLERKPKG------------------CSRAQLAKS 263

  Fly   286 SIKEMDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHK 350
            ..|.:..|::|:    |.:|.......::||.||...|....|:|||...:.:.:..:||:..|.
  Fly   264 YEKAIASYMSAS----CDLCEFSAPYLSELKTHFLEVHQREYYIKCCGKVFTRASKLMDHIRKHI 324

  Fly   351 DPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQE----LVHQCAICEARFAKKFLLTMHLKGHKGT 411
            :|:.|:|..|:|:..:::....|:...|::..:    |...|..||..|:.:..:..||..|...
  Fly   325 NPKLFTCTICKKSLNSQDYLATHIETVHNKVAQIGKVLKFPCPKCERTFSSERRMANHLAKHDTD 389

  Fly   412 ERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVA-E 475
            :....|:.|.|:|.....|..|::.:| .|....:|||||..|:.|.:|..|  .|...|.|| .
  Fly   390 QLEHTCEICCKSFANVHRLRRHIQSIH-EDLHRHVCDICGKKFKFKPSFERH--LLEHQGVVAPA 451

  Fly   476 VQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRH-KCSL 539
            |:|.:|..||::|.|||.|...||..|    ..|..|....:||.||..|::|.|....: :|:.
  Fly   452 VECPICRVWLKNEHSLRLHRFTHDSTD----TVCPHCGKTCTSRTALRGHVKYAHKLTTNLQCTF 512

  Fly   540 CDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKMHPNDWVRKYSQPSSSITST 604
            |:|.||..|.|.||||.|||:.||.|..|.:..:|.:||:.|.|:.|.::|:|            
  Fly   513 CEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADEWLR------------ 565

  Fly   605 AAPLAHPNHPN-QPA 618
             |.:|..::|. :||
  Fly   566 -AKMARSHNPQFKPA 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 24/75 (32%)
C2H2 Zn finger 332..349 CDD:275368 3/16 (19%)
C2H2 Zn finger 357..378 CDD:275368 4/20 (20%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 447..465 CDD:275368 9/17 (53%)
C2H2 Zn finger 478..498 CDD:275368 9/19 (47%)
C2H2 Zn finger 509..529 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 11/19 (58%)
C2H2 Zn finger 565..583 CDD:275368 6/17 (35%)
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 26/77 (34%)
C2H2 Zn finger 276..297 CDD:275368 6/20 (30%)
C2H2 Zn finger 306..323 CDD:275368 3/16 (19%)
C2H2 Zn finger 331..352 CDD:275368 4/20 (20%)
C2H2 Zn finger 366..386 CDD:275368 6/19 (32%)
C2H2 Zn finger 395..416 CDD:275368 6/20 (30%)
C2H2 Zn finger 424..444 CDD:275368 10/21 (48%)
C2H2 Zn finger 481..502 CDD:275368 8/20 (40%)
C2H2 Zn finger 510..530 CDD:275368 11/19 (58%)
C2H2 Zn finger 538..556 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.