DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and CG18262

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:503 Identity:105/503 - (20%)
Similarity:171/503 - (33%) Gaps:147/503 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LC------EPVIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQ 184
            ||      :|:     |.|..:....:....:...|:.||.|||.|.                  
  Fly    62 LCSNELESDPI-----AQDVVEVQGNEELHEELAKEASPDLEEEEEE------------------ 103

  Fly   185 THQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPD 249
                 |.:..||:...:|...:.:|.|:|....:::....|.|..:..:..||:|    ||    
  Fly   104 -----KEEGSKRQHYQRAAAMKNTLVETREDLLDIELDWTGGEQSEHNETHEEEE----GE---- 155

  Fly   250 ADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFND 314
                                  .|:|||          |:.:|  ..::...|..|.........
  Fly   156 ----------------------SDDDDT----------KDSND--TKDMLFQCDQCDRAYNTKRS 186

  Fly   315 LKRHFRVEH-DCTG--YVKCCNNRYKKRTLYVDHLHCHKDPQYFSC--QSCRKNFLNRNSQVMHM 374
            |:.|.|::| :..|  ..|..:.|..|:.        ...|:.:.|  ::|.:.|.....     
  Fly   187 LQSHRRLKHSEANGGSLDKSASERNSKKR--------KGPPKVYKCNEEACNQTFRTERD----- 238

  Fly   375 LRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHA 439
            ||.|..:...:. |.||...|.:...:..|.:.|.|. :|..|..|..||.|:.|||:|      
  Fly   239 LRGHRWKHTGIF-CDICGKPFTQSGNMMRHRQRHSGI-KPHKCPECDATFYTQKELSSH------ 295

  Fly   440 ADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGD 504
                    .||.|                  |.:..: |.:|||..||...|..|:.||   .|:
  Fly   296 --------SICHT------------------GRMPCI-CEVCGRPCRDRGVLTAHMRRH---TGE 330

  Fly   505 TKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCT 569
            ...:|.:|.....|...|:.|...|.:.:...|.:|...|:..:||..|...|:....|.|:.|.
  Fly   331 RPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCG 395

  Fly   570 RTFKSHANMHNHKKKMHPN---------------DWVRKYSQPSSSIT 602
            :||.....::.|.:...|.               :.:...|.|:::||
  Fly   396 KTFAQSGGLNAHMRSHDPARVKGAVKPLPQSVTIEVIEGKSPPTTTIT 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 5/22 (23%)
C2H2 Zn finger 388..408 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..438 CDD:275368 9/20 (45%)
C2H2 Zn finger 447..465 CDD:275368 3/17 (18%)
C2H2 Zn finger 478..498 CDD:275368 8/19 (42%)
C2H2 Zn finger 509..529 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 5/17 (29%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/26 (23%)
C2H2 Zn finger 251..271 CDD:275368 5/19 (26%)
COG5048 <256..415 CDD:227381 49/195 (25%)
zf-H2C2_2 263..288 CDD:290200 8/25 (32%)
C2H2 Zn finger 279..327 CDD:275368 21/80 (26%)
zf-H2C2_2 320..342 CDD:290200 7/24 (29%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-C2H2 389..411 CDD:278523 6/21 (29%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.