DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and ZNF660

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_775929.2 Gene:ZNF660 / 285349 HGNCID:26720 Length:331 Species:Homo sapiens


Alignment Length:350 Identity:93/350 - (26%)
Similarity:138/350 - (39%) Gaps:43/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 RPKTK--KLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHD 324
            |.||:  |..|..||...:|     .|.:|.:.        |.:.|..|..  |:     ||:.:
Human     2 RRKTRNFKHKTVKDNKVLTE-----GSDQESEK--------DNSQCCDPAT--NE-----RVQAE 46

  Fly   325 CTGYVKC--CNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQ 387
            ...|| |  |...:.:......|...|...:.:.|:.|.|.|.:.::.|:|. |.|:..:.  :.
Human    47 KRQYV-CTECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHR-RIHTGLKP--YT 107

  Fly   388 CAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGT 452
            |:.|...|:.|..|..|...|.| |:...|..|.|.|.....|.:| .|:|..: .|..|..||.
Human   108 CSECGKSFSGKSHLIRHQGIHSG-EKTYECKECGKAFSRSSGLISH-HRVHTGE-KPYSCIECGK 169

  Fly   453 HFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKS 517
            .|...:|...|:: :|....|  .:|..||:.......:..|...|   .|:..|.|..|.....
Human   170 AFSRSSNLTQHQR-MHRGKKV--YKCKECGKTCGSNTKIMDHQRIH---TGEKPYECDECGKTFI 228

  Fly   518 SRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKS------HA 576
            .|..|:.|.|.|...|.:||:.|.|.|...|.|.:|...|||...|:|..|.:||:.      |.
Human   229 LRKTLNEHQRLHRREKPYKCNECGKAFTSNRNLVDHQRVHTGEKPYKCNECGKTFRQTSQVILHL 293

  Fly   577 NMHNHKKKMHPNDWVRKYSQPSSSI 601
            ..|..:|....::..:.|...|..|
Human   294 RTHTKEKPYKCSECGKAYRYSSQLI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 7/20 (35%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 6/17 (35%)
C2H2 Zn finger 478..498 CDD:275368 4/19 (21%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..583 CDD:275368 6/23 (26%)
ZNF660NP_775929.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 11/45 (24%)
C2H2 Zn finger 52..72 CDD:275368 3/19 (16%)
zf-H2C2_2 64..89 CDD:316026 6/24 (25%)
C2H2 Zn finger 80..100 CDD:275368 7/20 (35%)
COG5048 <107..294 CDD:227381 58/195 (30%)
C2H2 Zn finger 108..128 CDD:275368 6/19 (32%)
C2H2 Zn finger 136..156 CDD:275368 7/20 (35%)
C2H2 Zn finger 164..184 CDD:275368 6/20 (30%)
C2H2 Zn finger 192..207 CDD:275368 3/14 (21%)
C2H2 Zn finger 220..240 CDD:275368 6/19 (32%)
C2H2 Zn finger 248..268 CDD:275368 7/19 (37%)
C2H2 Zn finger 276..296 CDD:275368 5/19 (26%)
C2H2 Zn finger 304..324 CDD:275368 2/14 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.