DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11696 and Zfp366

DIOPT Version :9

Sequence 1:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001004149.1 Gene:Zfp366 / 238803 MGIID:2178429 Length:746 Species:Mus musculus


Alignment Length:358 Identity:90/358 - (25%)
Similarity:131/358 - (36%) Gaps:72/358 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 PVKRSSIKEMDDYIAANVKLD---------------CAICAAPLEDFNDLKRHFR-----VEHDC 325
            |::....|:..:.:..||::|               |..|........:|..|..     ..|.|
Mouse   216 PLESEETKQKVERVDVNVQIDDSYYVDVGGAQKRWQCPTCEKSYTSKYNLVTHILGHSGIKPHAC 280

  Fly   326 TGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQEL-VHQCA 389
            :.    |...:|:.:....|:..|:..:...||.|.|.|    :|..|:.|...|..|: .|.|.
Mouse   281 SR----CGKLFKQLSHLHTHMLTHQGTRPHKCQVCHKAF----TQTSHLKRHMMQHSEVKPHNCR 337

  Fly   390 ICEARFAKKFLLTMH------------------------LKGHKGTERPEV---CDTCSKTFRTK 427
            :|...||....|..|                        ||.|..|.|..:   |..|.|||:..
Mouse   338 VCSRGFAYPSELKAHEAKHASGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYP 402

  Fly   428 FELSAHVKRMHAADFTPIICDICGTHF----RSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDE 488
            .:|..|:  |...|..|.||..||..|    ..|.:.|.||       .|.|.:|.:|||.....
Mouse   403 SQLQNHM--MKHKDIRPYICSECGMEFVQPHHLKQHSLTHK-------GVKEHKCGICGREFTLL 458

  Fly   489 RSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEH 553
            .::::|:..|.:   ...|:|.||......:..|.:||..|...|..||.||.|||.....|..|
Mouse   459 ANMKRHVLIHTN---IRAYQCHLCYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGH 520

  Fly   554 MATHTGIDLYQCQFCTRTFKSHANMHNHKKKMH 586
            :..|:....::|.:|...|....|:..|.|..|
Mouse   521 LHLHSDSKPFKCLYCPSKFTLKGNLTRHMKVKH 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 3/16 (19%)
C2H2 Zn finger 357..378 CDD:275368 8/20 (40%)
C2H2 Zn finger 388..408 CDD:275368 8/43 (19%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 7/21 (33%)
C2H2 Zn finger 478..498 CDD:275368 5/19 (26%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 8/19 (42%)
C2H2 Zn finger 565..583 CDD:275368 5/17 (29%)
Zfp366NP_001004149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
FtsK <51..>227 CDD:332908 2/10 (20%)
COG5048 250..>546 CDD:227381 82/315 (26%)
C2H2 Zn finger 252..272 CDD:275368 4/19 (21%)
C2H2 Zn finger 280..300 CDD:275368 4/23 (17%)
C2H2 Zn finger 308..328 CDD:275368 8/23 (35%)
C2H2 Zn finger 336..356 CDD:275368 6/19 (32%)
C2H2 Zn finger 364..384 CDD:275368 3/19 (16%)
C2H2 Zn finger 392..412 CDD:275368 8/21 (38%)
C2H2 Zn finger 420..440 CDD:275368 6/19 (32%)
C2H2 Zn finger 448..468 CDD:275368 5/19 (26%)
Interaction with NRIP1. /evidence=ECO:0000250|UniProtKB:Q8N895 452..746 30/105 (29%)
C2H2 Zn finger 476..496 CDD:275368 6/19 (32%)
C2H2 Zn finger 504..524 CDD:275368 8/19 (42%)
C2H2 Zn finger 532..551 CDD:275368 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..689
PXDLS. /evidence=ECO:0000250|UniProtKB:Q8N895 587..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.