DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11696 and klf-3

DIOPT Version :9

Sequence 1:	NP_572731.1	Gene:	CG11696 / 32104	FlyBaseID:	FBgn0030314	Length:	664	Species:	Drosophila melanogaster
Sequence 2:	NP_001022205.1	Gene:	klf-3 / 191713	WormBaseID:	WBGene00003480	Length:	315	Species:	Caenorhabditis elegans

Alignment Length:	117	Identity:	36/117 - (30%)
Similarity:	54/117 - (46%)	Gaps:	13/117 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   356 SCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAI--CEARFAKKFLLTMHLKGHKGT---ERPE 415
            |..|..::.|.|.|::....|..:.::.:||.|..  |    .||:..:.|||.|:.|   |:|.
Worm   200 STTSSERSPLQRKSRIESNKRNPTDKKFVVHACTYPGC----FKKYSKSSHLKAHERTHSGEKPF 260

  Fly   416 VC--DTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKK 465
            ||  ..||..|....||:.|: |.|..| .|..|.:|..:|....:..:|.|
Worm   261 VCKWQNCSWKFARSDELTRHM-RKHTGD-KPFRCSLCDRNFARSDHLSLHMK 310

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11696	NP_572731.1	zf-AD	2..78	CDD:285071
		C2H2 Zn finger	332..349	CDD:275368
		C2H2 Zn finger	357..378	CDD:275368	5/20 (25%)
		C2H2 Zn finger	388..408	CDD:275368	7/21 (33%)
		C2H2 Zn finger	417..438	CDD:275368	8/22 (36%)
		C2H2 Zn finger	447..465	CDD:275368	4/17 (24%)
		C2H2 Zn finger	478..498	CDD:275368
		C2H2 Zn finger	509..529	CDD:275368
		C2H2 Zn finger	537..557	CDD:275368
		C2H2 Zn finger	565..583	CDD:275368
klf-3	NP_001022205.1	C2H2 Zn finger	235..254	CDD:275368	7/22 (32%)
		C2H2 Zn finger	262..284	CDD:275368	8/22 (36%)
		zf-H2C2_2	276..301	CDD:290200	10/26 (38%)
		C2H2 Zn finger	292..312	CDD:275368	5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000