| Sequence 1: | NP_572731.1 | Gene: | CG11696 / 32104 | FlyBaseID: | FBgn0030314 | Length: | 664 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011514003.1 | Gene: | ZNF783 / 100289678 | HGNCID: | 27222 | Length: | 557 | Species: | Homo sapiens |
| Alignment Length: | 221 | Identity: | 59/221 - (26%) |
|---|---|---|---|
| Similarity: | 77/221 - (34%) | Gaps: | 41/221 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 412 ERPEVCDTCSKTFRTKFELSAHVK------RMHAADFTPIICDICGTHFRSKANFLIHKKALHPD 470
Fly 471 GPVAEVQCTLCGRWLRDE----RSLRKHLARHDDRDGDTK-YRCLLCNAEKSSRAALSSHMRYH- 529
Fly 530 -HSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKMHPNDWVRK 593
Fly 594 YSQPSSSITSTAAPLAHPNHPNQPAP 619 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11696 | NP_572731.1 | zf-AD | 2..78 | CDD:285071 | |
| C2H2 Zn finger | 332..349 | CDD:275368 | |||
| C2H2 Zn finger | 357..378 | CDD:275368 | |||
| C2H2 Zn finger | 388..408 | CDD:275368 | |||
| C2H2 Zn finger | 417..438 | CDD:275368 | 8/26 (31%) | ||
| C2H2 Zn finger | 447..465 | CDD:275368 | 1/17 (6%) | ||
| C2H2 Zn finger | 478..498 | CDD:275368 | 7/23 (30%) | ||
| C2H2 Zn finger | 509..529 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 537..557 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 565..583 | CDD:275368 | 7/17 (41%) | ||
| ZNF783 | XP_011514003.1 | DUF3669 | 68..123 | CDD:289202 | |
| KRAB | 154..213 | CDD:214630 | |||
| KRAB_A-box | 154..193 | CDD:143639 | |||
| zf-C2H2 | 360..382 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 362..382 | CDD:275370 | 7/19 (37%) | ||
| C2H2 Zn finger | 449..469 | CDD:275368 | 6/19 (32%) | ||
| COG5048 | 479..>527 | CDD:227381 | 20/52 (38%) | ||
| C2H2 Zn finger | 479..499 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 479..499 | CDD:278523 | 7/19 (37%) | ||
| zf-H2C2_2 | 491..516 | CDD:290200 | 12/29 (41%) | ||
| C2H2 Zn finger | 507..527 | CDD:275368 | 8/24 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165156305 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||