DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reepl1 and YOP1

DIOPT Version :10

Sequence 1:NP_572730.1 Gene:Reepl1 / 32103 FlyBaseID:FBgn0030313 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_015353.1 Gene:YOP1 / 856140 SGDID:S000006232 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:27/87 - (31%)
Similarity:44/87 - (50%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILSLLVGCFYPAFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIPLLSEFK-V 72
            |||...|...||:.|...||:.. |.:|.: .|.|||.:......::::..:|..||.....| |
Yeast    61 ILSNFAGFVLPAYLSLVALKTPT-STDDTQ-LLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTV 123

  Fly    73 LLLFWMLPSVGGGSEVIYEEFL 94
            .|::..||.. ||:.:||::.:
Yeast   124 FLIYIALPQT-GGARMIYQKIV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reepl1NP_572730.1 TB2_DP1_HVA22 19..97 CDD:460820 23/77 (30%)
YOP1NP_015353.1 YOP1 1..180 CDD:227385 27/87 (31%)

Return to query results.
Submit another query.