DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reepl1 and HVA22E

DIOPT Version :10

Sequence 1:NP_572730.1 Gene:Reepl1 / 32103 FlyBaseID:FBgn0030313 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_568744.1 Gene:HVA22E / 835144 AraportID:AT5G50720 Length:116 Species:Arabidopsis thaliana


Alignment Length:86 Identity:26/86 - (30%)
Similarity:43/86 - (50%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVGCFYPAFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIPLLSEFKVLLLFW 77
            :|...||.:||...::|.: .|:| ..||.|||.|......:.....||.:||:....|::.:.|
plant    18 VVMLLYPLYASVIAIESPS-KVDD-EQWLAYWILYSFLTLSELILQSLLEWIPIWYTAKLVFVAW 80

  Fly    78 M-LPSVGGG----SEVIYEEF 93
            : ||...|.    ::|:.|:|
plant    81 LVLPQFRGAAFIYNKVVREQF 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reepl1NP_572730.1 TB2_DP1_HVA22 19..97 CDD:460820 24/80 (30%)
HVA22ENP_568744.1 TB2_DP1_HVA22 24..98 CDD:460820 22/75 (29%)

Return to query results.
Submit another query.