DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reepl1 and reep6

DIOPT Version :10

Sequence 1:NP_572730.1 Gene:Reepl1 / 32103 FlyBaseID:FBgn0030313 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_009304084.1 Gene:reep6 / 447918 ZFINID:ZDB-GENE-040912-98 Length:213 Species:Danio rerio


Alignment Length:86 Identity:30/86 - (34%)
Similarity:43/86 - (50%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVGCFYPAFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIPLLSEFKVLLLFW 77
            |:|..|||:.|.|.::|.  ...|...||.||:.||.:...::|:...|.:.|.....|.|.|.|
Zfish    64 LIGFVYPAYFSIKAIESP--GKEDDTQWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLW 126

  Fly    78 -MLPSVGGGSEVIYEEFLRSF 97
             |.|....||:|:|...:|.|
Zfish   127 CMAPVSWNGSQVLYRHVVRPF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reepl1NP_572730.1 TB2_DP1_HVA22 19..97 CDD:460820 26/78 (33%)
reep6XP_009304084.1 TB2_DP1_HVA22 70..147 CDD:460820 26/78 (33%)

Return to query results.
Submit another query.